Protein Family IF09518

Metagenome Isolate
151 Members
54 Samples
142 Scaffolds
246.3 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_475467|Ga0466704_475467_427_1194
Length
255 aa
Sequence
MQHYGLIGYPLKHSFSKDYFNDKFEAERIDAQYLNFEIPSIRDFKTILSEHPHLEGLNVTIPYKEQVIPFLDRLSENAQLIGAVNVIKIERNKGKIKRLTGFNSDIIGFKQSIEPLLQPHHRKALVLGTGGAAKAIYYGLSQLGIEPTYVAREKQSDTVLTYSELNAQDMAAQTVIVNCTPVGMWPHVDECPKIPYECLTEQHLLYDLLYNPNETLFMKYGAEQGATVKNGLEMLLLQAFASWEFWRNGTTEAAK

📊 Sample Types

Isolate 6.0%
Metagenome 94.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 25.9%
Unclassified 14.8%
Rhinotermitidae 7.4%
Termopsidae 5.6%
Hydrophilidae 3.7%
Passalidae 3.7%
Hodotermitidae 1.9%
Tenebrionidae 1.9%
Blattidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
2 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
16 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
24 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
39 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
40 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
45 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
46 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_213899 3300042659 Bacteria 6656
2 Ga0466692_084653 3300042591 Bacteria 16158
3 Ga0466694_346395 3300042594 Bacteria 4069
4 Ga0466711_350857 3300042615 Bacteria 51542
5 Ga0123354_10001155 3300010882 Bacteria 30901
6 Ga0123354_10209160 3300010882 Bacteria 2115
7 JGI24699J35502_11134110 3300002509 Bacteria 31696
8 Ga0123357_10000872 3300009784 Bacteria 30777
9 Ga0466707_045632 3300042601 Bacteria 15295
10 Ga0466713_008813 3300042602 Bacteria 15834
11 Ga0466722_248161 3300042609 Bacteria 13887
12 Ga0466729_280059 3300042621 Bacteria 1183
13 Ga0466735_038239 3300042624 Bacteria 1113
14 Ga0466735_179575 3300042624 Bacteria 1455
15 Ga0466730_094010 3300042625 Bacteria 2264
16 Ga0466708_006861 3300042652 Bacteria 10307
17 Ga0466705_232740 3300042612 Bacteria 7883
18 Ga0466733_195509 3300042659 Bacteria 83582
19 Ga0466692_183742 3300042591 Bacteria 15201
20 Ga0466701_009575 3300042598 Bacteria 7532
21 Ga0466723_367514 3300042618 Bacteria 1631
22 Ga0466726_029778 3300042619 Bacteria 38816
23 Ga0123356_11353666 3300010049 Bacteria 874
24 Ga0123354_10080670 3300010882 Bacteria 4603
25 Ga0123354_10332128 3300010882 Bacteria 1384
26 Ga0466713_037010 3300042602 Bacteria 2734
27 Ga0466716_033455 3300042605 Bacteria 5469
28 Ga0466716_155217 3300042605 Bacteria 1604
29 Ga0466719_422169 3300042606 Bacteria 6241
30 Ga0466734_112146 3300042623 Bacteria 1027
31 Ga0466735_048431 3300042624 Bacteria 1783
32 Ga0466704_387159 3300042643 Bacteria 11253
33 Ga0466704_456616 3300042643 Bacteria 35507
34 Ga0466727_205527 3300042655 Bacteria 11545
35 Ga0466733_221141 3300042659 Bacteria 323281
36 Ga0466690_169422 3300042590 Bacteria 39612
37 Ga0466691_203048 3300042593 Bacteria 4850
38 Ga0466705_522015 3300042612 Bacteria 1291
39 Ga0466711_329548 3300042615 Bacteria 10051
40 Ga0123357_10064926 3300009784 Bacteria 4875
41 Ga0123356_10652320 3300010049 Bacteria 1220
42 Ga0123354_10156686 3300010882 Bacteria 2728
43 2227489109 2225789004 Unclassified 4142
44 Ga0068305_10254952 3300005083 Bacteria 3640
45 Ga0123357_10002530 3300009784 Bacteria 20462
46 Ga0466706_276180 3300042599 Bacteria 65753
47 Ga0466707_117040 3300042601 Bacteria 22070
48 Ga0466713_000079 3300042602 Bacteria 9723
49 Ga0466713_044686 3300042602 Bacteria 17655
50 Ga0466713_099518 3300042602 Bacteria 11417
51 Ga0466719_184892 3300042606 Bacteria 10895
52 Ga0466722_123031 3300042609 Bacteria 32122
53 Ga0466698_330165 3300042610 Bacteria 1829
54 Ga0466735_139595 3300042624 Bacteria 8713
55 Ga0466727_078492 3300042655 Bacteria 66886
56 Ga0466732_071103 3300042656 Bacteria 1765
57 Ga0466690_213523 3300042590 Bacteria 18139
58 Ga0466726_251828 3300042619 Bacteria 2987
59 Ga0466726_379854 3300042619 Bacteria 1247
60 Ga0466728_111999 3300042620 Bacteria 4087
61 Ga0123357_10004638 3300009784 Bacteria 16215
62 Ga0123353_10535149 3300010167 Bacteria 1695
63 IMNBL1DRAFT_c0004204 3300000062 Bacteria 8749
64 JGI24699J35502_11133947 3300002509 Bacteria 20626
65 Ga0068305_10111646 3300005083 Bacteria 2645
66 Ga0466700_255519 3300042600 Bacteria 3249
67 Ga0466700_435179 3300042600 Bacteria 4390
68 Ga0466703_287233 3300042636 Bacteria 1510
69 Ga0466703_377998 3300042636 Bacteria 2417
70 Ga0466697_102833 3300042611 Bacteria 2030
71 Ga0466656_182629 3300042550 Bacteria 2679
72 Ga0466691_005837 3300042593 Bacteria 2664
73 Ga0466696_243101 3300042596 Bacteria 6507
74 Ga0466723_269975 3300042618 Bacteria 19626
75 Ga0466726_144572 3300042619 Bacteria 3072
76 Ga0123357_10064022 3300009784 Bacteria 4916
77 Ga0123356_10822056 3300010049 Bacteria 1100
78 Ga0123354_10006587 3300010882 Bacteria 17289
79 2227482436 2225789004 Bacteria 4379
80 IMNBL1DRAFT_c0007321 3300000062 Bacteria 5834
81 JGI24702J35022_10042374 3300002462 Bacteria 2424
82 Ga0466713_104624 3300042602 Bacteria 5452
83 Ga0466713_123723 3300042602 Bacteria 198668
84 Ga0466735_116596 3300042624 Bacteria 6529
85 Ga0466703_305044 3300042636 Bacteria 6580
86 Ga0466725_101792 3300042654 Bacteria 2834
87 Ga0466727_033460 3300042655 Bacteria 3360
88 Ga0466692_083632 3300042591 Bacteria 30510
89 Ga0466691_151994 3300042593 Bacteria 12011
90 Ga0466705_522137 3300042612 Bacteria 3314
91 Ga0466715_137211 3300042616 Bacteria 4758
92 Ga0466723_274504 3300042618 Bacteria 2147
93 Ga0466729_045459 3300042621 Bacteria 7957
94 Ga0123357_10116171 3300009784 Bacteria 3389
95 Ga0123356_10475452 3300010049 Bacteria 1402
96 IMNBL1DRAFT_c0004767 3300000062 Bacteria 8011
97 Ga0466707_017877 3300042601 Bacteria 16904
98 Ga0466716_395133 3300042605 Bacteria 6728
99 Ga0466719_040113 3300042606 Bacteria 1912
100 Ga0466735_023932 3300042624 Bacteria 1951
101 Ga0466735_066837 3300042624 Bacteria 5459
102 Ga0466735_120540 3300042624 Bacteria 1681
103 Ga0466703_148257 3300042636 Bacteria 24506
104 Ga0466704_569440 3300042643 Bacteria 2271
105 Ga0466709_039419 3300042648 Bacteria 67557
106 Ga0466727_305974 3300042655 Bacteria 9046
107 Ga0466697_225383 3300042611 Bacteria 1453
108 Ga0562377_0004 3300056842 Bacteria 3525959
109 Ga0466690_133036 3300042590 Bacteria 7695
110 Ga0466692_021898 3300042591 Bacteria 3903
111 Ga0466715_367302 3300042616 Bacteria 9027
112 Ga0123353_10665689 3300010167 Bacteria 1470
113 JGI24699J35502_10986423 3300002509 Bacteria 1292
114 JGI24699J35502_11134146 3300002509 Bacteria 37464
115 Ga0068305_10176128 3300005083 Bacteria 2187
116 Ga0072940_1484835 3300005200 Bacteria 1277
117 Ga0466700_093193 3300042600 Bacteria 4167
118 Ga0466700_369835 3300042600 Bacteria 46737
119 Ga0466707_009633 3300042601 Bacteria 35190
120 Ga0466713_050394 3300042602 Bacteria 6134
121 Ga0466713_118181 3300042602 Bacteria 33659
122 Ga0466735_195877 3300042624 Bacteria 2225
123 Ga0466703_062082 3300042636 Bacteria 16507
124 Ga0466703_227876 3300042636 Bacteria 3299
125 Ga0466703_364345 3300042636 Bacteria 3780
126 Ga0466704_475467 3300042643 Bacteria 2521
127 Ga0466709_397134 3300042648 Bacteria 10448
128 Ga0466711_120514 3300042615 Bacteria 6869
129 Ga0466715_376224 3300042616 Bacteria 43713
130 Ga0123357_10635048 3300009784 Bacteria 799
131 Ga0123356_10006425 3300010049 Bacteria 11847
132 IMNBL1DRAFT_c0003050 3300000062 Bacteria 11056
133 IMNBL1DRAFT_c0008300 3300000062 Bacteria 5304
134 JGI24702J35022_10000956 3300002462 Bacteria 18036
135 JGI24702J35022_10050265 3300002462 Bacteria 2220
136 Ga0466701_069835 3300042598 Bacteria 26434
137 Ga0466700_265932 3300042600 Bacteria 1687
138 Ga0466707_057971 3300042601 Bacteria 5446
139 Ga0466707_120405 3300042601 Bacteria 3472
140 Ga0466735_007579 3300042624 Bacteria 4984
141 Ga0466735_117409 3300042624 Bacteria 7366
142 Ga0466735_119363 3300042624 Bacteria 1392

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_033455 Ga0466716_033455_450_1199 214
2 3300042605 Ga0466716_155217 Ga0466716_155217_407_1156 215
3 3300042621 Ga0466729_280059 Ga0466729_280059_388_1134 225
4 3300042636 Ga0466703_377998 Ga0466703_377998_276_1022 227
5 3300042598 Ga0466701_069835 Ga0466701_069835_24282_25028 228
6 3300042624 Ga0466735_023932 Ga0466735_023932_305_1051 229
7 3300042636 Ga0466703_148257 Ga0466703_148257_17395_18138 229
8 3300042624 Ga0466735_038239 Ga0466735_038239_11_727 230
9 3300042636 Ga0466703_287233 Ga0466703_287233_151_843 230
10 3300042643 Ga0466704_569440 Ga0466704_569440_1461_2210 230
11 3300042596 Ga0466696_243101 Ga0466696_243101_2868_3563 231
12 3300002509 JGI24699J35502_11134110 JGI24699J35502_1113411012 232
13 3300042620 Ga0466728_111999 Ga0466728_111999_752_1495 232
14 3300042602 Ga0466713_044686 Ga0466713_044686_9191_9895 234
15 3300042615 Ga0466711_329548 Ga0466711_329548_8337_9089 234
16 3300042636 Ga0466703_227876 Ga0466703_227876_2148_2924 236
17 3300042601 Ga0466707_009633 Ga0466707_009633_24259_25038 237
18 3300042590 Ga0466690_133036 Ga0466690_133036_4422_5171 239
19 3300042591 Ga0466692_084653 Ga0466692_084653_11867_12613 239
20 3300000062 IMNBL1DRAFT_c0003050 IMNBL1DRAFT_00030504 241
21 3300042654 Ga0466725_101792 Ga0466725_101792_1889_2617 242
22 3300042600 Ga0466700_255519 Ga0466700_255519_1630_2379 243
23 3300042623 Ga0466734_112146 Ga0466734_112146_285_1016 243
24 3300042594 Ga0466694_346395 Ga0466694_346395_728_1468 246
25 3300042602 Ga0466713_000079 Ga0466713_000079_160_900 246
26 3300042602 Ga0466713_037010 Ga0466713_037010_1100_1840 246
27 3300042615 Ga0466711_120514 Ga0466711_120514_888_1628 246
28 3300042615 Ga0466711_350857 Ga0466711_350857_4864_5604 246
29 3300042624 Ga0466735_179575 Ga0466735_179575_511_1251 246
30 3300042624 Ga0466735_195877 Ga0466735_195877_830_1570 246
31 3300042636 Ga0466703_062082 Ga0466703_062082_5069_5809 246
32 3300042636 Ga0466703_364345 Ga0466703_364345_403_1143 246
33 3300042643 Ga0466704_456616 Ga0466704_456616_25910_26650 246
34 3300005083 Ga0068305_10111646 Ga0068305_101116463 247
35 3300042591 Ga0466692_183742 Ga0466692_183742_1364_2107 247
36 3300042593 Ga0466691_151994 Ga0466691_151994_10151_10894 247
37 3300042599 Ga0466706_276180 Ga0466706_276180_52654_53397 247
38 3300042601 Ga0466707_017877 Ga0466707_017877_7998_8741 247
39 3300042602 Ga0466713_008813 Ga0466713_008813_2439_3182 247
40 3300042602 Ga0466713_050394 Ga0466713_050394_2359_3102 247
41 3300042602 Ga0466713_118181 Ga0466713_118181_14801_15544 247
42 3300042602 Ga0466713_123723 Ga0466713_123723_23982_24725 247
43 3300042606 Ga0466719_184892 Ga0466719_184892_1690_2433 247
44 3300042606 Ga0466719_422169 Ga0466719_422169_4516_5259 247
45 3300042609 Ga0466722_123031 Ga0466722_123031_27357_28100 247
46 3300042609 Ga0466722_248161 Ga0466722_248161_5097_5840 247
47 3300042610 Ga0466698_330165 Ga0466698_330165_121_864 247
48 3300042611 Ga0466697_225383 Ga0466697_225383_459_1202 247
49 3300042612 Ga0466705_522015 Ga0466705_522015_379_1122 247
50 3300042612 Ga0466705_522137 Ga0466705_522137_1022_1765 247
51 3300042616 Ga0466715_137211 Ga0466715_137211_2714_3457 247
52 3300042619 Ga0466726_029778 Ga0466726_029778_28843_29586 247
53 3300042621 Ga0466729_045459 Ga0466729_045459_438_1181 247
54 3300042624 Ga0466735_139595 Ga0466735_139595_2868_3611 247
55 3300042625 Ga0466730_094010 Ga0466730_094010_109_852 247
56 3300042655 Ga0466727_078492 Ga0466727_078492_64364_65107 247
57 3300042659 Ga0466733_213899 Ga0466733_213899_4069_4812 247
58 3300042659 Ga0466733_221141 Ga0466733_221141_98833_99576 247
59 iso_pr_bacteria 2820759988 2820762091 247
60 iso_pr_bacteria 2967483437 2967487301 247
61 3300002462 JGI24702J35022_10000956 JGI24702J35022_100009568 248
62 3300002462 JGI24702J35022_10042374 JGI24702J35022_100423743 248
63 3300002462 JGI24702J35022_10050265 JGI24702J35022_100502652 248
64 3300002509 JGI24699J35502_11134146 JGI24699J35502_1113414625 248
65 3300005083 Ga0068305_10176128 Ga0068305_101761281 248
66 3300009784 Ga0123357_10000872 Ga0123357_100008729 248
67 3300009784 Ga0123357_10004638 Ga0123357_100046383 248
68 3300009784 Ga0123357_10064022 Ga0123357_100640224 248
69 3300009784 Ga0123357_10635048 Ga0123357_106350481 248
70 3300010049 Ga0123356_10006425 Ga0123356_100064253 248
71 3300010049 Ga0123356_10475452 Ga0123356_104754522 248
72 3300010049 Ga0123356_10822056 Ga0123356_108220561 248
73 3300010167 Ga0123353_10665689 Ga0123353_106656893 248
74 3300010882 Ga0123354_10001155 Ga0123354_100011552 248
75 3300010882 Ga0123354_10156686 Ga0123354_101566862 248
76 3300010882 Ga0123354_10332128 Ga0123354_103321282 248
77 3300042550 Ga0466656_182629 Ga0466656_182629_1211_1957 248
78 3300042590 Ga0466690_169422 Ga0466690_169422_2860_3606 248
79 3300042591 Ga0466692_021898 Ga0466692_021898_3107_3853 248
80 3300042593 Ga0466691_203048 Ga0466691_203048_972_1718 248
81 3300042600 Ga0466700_093193 Ga0466700_093193_1177_1923 248
82 3300042600 Ga0466700_265932 Ga0466700_265932_252_998 248
83 3300042600 Ga0466700_435179 Ga0466700_435179_140_886 248
84 3300042618 Ga0466723_269975 Ga0466723_269975_13119_13865 248
85 3300042619 Ga0466726_379854 Ga0466726_379854_289_1035 248
86 3300042655 Ga0466727_305974 Ga0466727_305974_5891_6637 248
87 3300042656 Ga0466732_071103 Ga0466732_071103_628_1374 248
88 3300042659 Ga0466733_195509 Ga0466733_195509_69739_70485 248
89 iso_pr_bacteria 2695420317 2695483646 248
90 iso_pr_bacteria 2820778767 2820781408 248
91 iso_pr_bacteria 2873600114 2873601272 248
92 iso_pr_bacteria 2873610414 2873611625 248
93 iso_pr_bacteria 2940216256 2940216742 248
94 iso_pr_bacteria 8100157865 8100160293 248
95 3300002509 JGI24699J35502_10986423 JGI24699J35502_109864232 249
96 3300002509 JGI24699J35502_11133947 JGI24699J35502_111339476 249
97 3300005200 Ga0072940_1484835 Ga0072940_14848351 249
98 3300009784 Ga0123357_10064926 Ga0123357_100649264 249
99 3300009784 Ga0123357_10116171 Ga0123357_101161712 249
100 3300010049 Ga0123356_10652320 Ga0123356_106523202 249
101 3300010882 Ga0123354_10006587 Ga0123354_100065878 249
102 3300010882 Ga0123354_10080670 Ga0123354_100806701 249
103 3300042591 Ga0466692_083632 Ga0466692_083632_19451_20200 249
104 3300042600 Ga0466700_369835 Ga0466700_369835_15458_16207 249
105 3300042602 Ga0466713_104624 Ga0466713_104624_3136_3885 249
106 3300042611 Ga0466697_102833 Ga0466697_102833_1053_1820 249
107 3300042616 Ga0466715_376224 Ga0466715_376224_7372_8121 249
108 3300042619 Ga0466726_144572 Ga0466726_144572_1997_2746 249
109 3300042619 Ga0466726_251828 Ga0466726_251828_859_1608 249
110 3300042624 Ga0466735_007579 Ga0466735_007579_3604_4353 249
111 3300000062 IMNBL1DRAFT_c0004767 IMNBL1DRAFT_000476710 250
112 3300000062 IMNBL1DRAFT_c0008300 IMNBL1DRAFT_00083004 250
113 3300009784 Ga0123357_10002530 Ga0123357_1000253017 250
114 3300010167 Ga0123353_10535149 Ga0123353_105351492 250
115 3300042590 Ga0466690_213523 Ga0466690_213523_11035_11787 250
116 3300042593 Ga0466691_005837 Ga0466691_005837_276_1028 250
117 3300042601 Ga0466707_045632 Ga0466707_045632_2544_3296 250
118 3300042601 Ga0466707_057971 Ga0466707_057971_1853_2605 250
119 3300042601 Ga0466707_120405 Ga0466707_120405_784_1536 250
120 3300042602 Ga0466713_099518 Ga0466713_099518_3462_4214 250
121 3300042605 Ga0466716_395133 Ga0466716_395133_2115_2867 250
122 3300042606 Ga0466719_040113 Ga0466719_040113_1073_1825 250
123 3300042618 Ga0466723_274504 Ga0466723_274504_112_864 250
124 3300042618 Ga0466723_367514 Ga0466723_367514_828_1580 250
125 3300042624 Ga0466735_066837 Ga0466735_066837_1169_1921 250
126 3300042624 Ga0466735_119363 Ga0466735_119363_442_1194 250
127 3300042624 Ga0466735_120540 Ga0466735_120540_228_980 250
128 3300042636 Ga0466703_305044 Ga0466703_305044_4902_5654 250
129 3300042643 Ga0466704_387159 Ga0466704_387159_3921_4673 250
130 3300042648 Ga0466709_039419 Ga0466709_039419_58958_59710 250
131 3300042648 Ga0466709_397134 Ga0466709_397134_56_808 250
132 3300042652 Ga0466708_006861 Ga0466708_006861_1640_2392 250
133 3300056842 Ga0562377_0004 Ga0562377_0004_2618776_2619528 250
134 iso_pr_bacteria 2820762746 2820764042 250
135 2225789004 2227482436 2227944381 251
136 2225789004 2227489109 2227959012 251
137 3300005083 Ga0068305_10254952 Ga0068305_102549522 251
138 3300010882 Ga0123354_10209160 Ga0123354_102091603 251
139 3300042624 Ga0466735_048431 Ga0466735_048431_634_1389 251
140 3300042624 Ga0466735_116596 Ga0466735_116596_2034_2789 251
141 3300042655 Ga0466727_033460 Ga0466727_033460_2441_3196 251
142 3300042655 Ga0466727_205527 Ga0466727_205527_717_1472 251
143 3300000062 IMNBL1DRAFT_c0004204 IMNBL1DRAFT_00042046 252
144 3300000062 IMNBL1DRAFT_c0007321 IMNBL1DRAFT_00073214 252
145 3300042624 Ga0466735_117409 Ga0466735_117409_5492_6250 252
146 3300042612 Ga0466705_232740 Ga0466705_232740_2687_3448 253
147 3300042616 Ga0466715_367302 Ga0466715_367302_4269_5030 253
148 3300010049 Ga0123356_11353666 Ga0123356_113536661 254
149 3300042601 Ga0466707_117040 Ga0466707_117040_12753_13520 255
150 3300042643 Ga0466704_475467 Ga0466704_475467_427_1194 255
151 3300042598 Ga0466701_009575 Ga0466701_009575_3857_4678 273

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain 6 87 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08501 GO:0004764 shikimate 3-dehydrogenase (NADP+) activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.