Protein Family IF09504

Metagenome Isolate
178 Members
70 Samples
146 Scaffolds
106.31 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_417078|Ga0466704_417078_789_1106
Length
105 aa
Sequence
MKKSLLEAASVIRSKNSGPFELTLDIIFKDAQAYRKICEEQQITPQMAADLYHVPLSEILNFVWYAPANSLKITLKRPIDSGSIGERDTYGAQQYAPLLALTVDI

📊 Sample Types

Isolate 18.0%
Metagenome 82.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.1%
Termitidae 22.9%
Blattidae 18.6%
Kalotermitidae 18.6%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Passalidae 2.9%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 163
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
2 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
3 2922326829 Bacteroides sp. 224 Isolate Blattidae
4 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
5 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
10 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
11 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
12 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
13 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3004667792 Bacteroides sp. 519 Isolate Blattidae
18 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
19 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
20 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
23 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
24 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
25 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3004672520 Bacteroides sp. 51 Isolate Blattidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
30 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
31 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
32 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
33 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
34 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
35 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
40 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
46 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
47 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
50 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
51 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
52 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
53 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
59 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
60 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
61 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
62 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
63 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
64 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
65 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
66 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
67 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
68 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
69 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
70 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_014980 3300042598 Bacteria 1168
2 Ga0466706_011673 3300042599 Bacteria 3417
3 Ga0123355_10167020 3300009826 Bacteria 3299
4 Ga0123355_10634639 3300009826 Bacteria 1253
5 Ga0123353_10021459 3300010167 Bacteria 9696
6 Ga0123353_10681660 3300010167 Bacteria 1447
7 Ga0123353_10981199 3300010167 Bacteria 1138
8 Ga0123353_11017639 3300010167 Bacteria 1111
9 Ga0123353_11516405 3300010167 Bacteria 853
10 2227064010 2225789003 Unclassified 737
11 IMNBL1DRAFT_c0003545 3300000062 Bacteria 9941
12 JGI24695J34938_10006950 3300002450 Bacteria 6716
13 Ga0466735_013196 3300042624 Bacteria 1557
14 Ga0466703_124909 3300042636 Unclassified 2632
15 Ga0466704_344304 3300042643 Bacteria 5917
16 Ga0466715_391740 3300042616 Bacteria 7851
17 Ga0466714_147744 3300042603 Bacteria 2168
18 Ga0123355_10000293 3300009826 Bacteria 64130
19 Ga0123355_10001005 3300009826 Bacteria 39113
20 Ga0123355_10005031 3300009826 Bacteria 19257
21 Ga0123355_10089759 3300009826 Bacteria 4877
22 Ga0123355_10744698 3300009826 Bacteria 1110
23 Ga0123355_10866989 3300009826 Bacteria 989
24 Ga0123355_10877815 3300009826 Bacteria 980
25 Ga0123356_10076237 3300010049 Bacteria 3160
26 Ga0123356_10505631 3300010049 Unclassified 1365
27 Ga0123356_11166873 3300010049 Bacteria 937
28 Ga0123356_12946061 3300010049 Bacteria 595
29 Ga0123353_10266766 3300010167 Bacteria 2640
30 Ga0123353_12368975 3300010167 Bacteria 636
31 Ga0466705_099458 3300042612 Bacteria 1338
32 Ga0466704_164622 3300042643 Bacteria 6539
33 Ga0466725_372785 3300042654 Bacteria 2070
34 Ga0466711_195067 3300042615 Bacteria 4352
35 Ga0466715_086153 3300042616 Bacteria 1347
36 Ga0466696_129425 3300042596 Unclassified 1038
37 Ga0466716_395861 3300042605 Bacteria 23642
38 Ga0466719_176669 3300042606 Bacteria 2634
39 Ga0466722_008569 3300042609 Bacteria 9082
40 Ga0123355_10013944 3300009826 Bacteria 12532
41 Ga0123355_10058764 3300009826 Bacteria 6219
42 Ga0123355_10898812 3300009826 Bacteria 963
43 Ga0123355_11239788 3300009826 Unclassified 756
44 Ga0123356_11019168 3300010049 Unclassified 998
45 Ga0123356_11134170 3300010049 Bacteria 949
46 Ga0123356_11185006 3300010049 Bacteria 930
47 Ga0123353_10133535 3300010167 Bacteria 3982
48 Ga0123353_10171645 3300010167 Bacteria 3442
49 Ga0123353_10234432 3300010167 Bacteria 2858
50 Ga0123353_10730959 3300010167 Bacteria 1382
51 Ga0123353_11065091 3300010167 Bacteria 1078
52 Ga0123357_10000232 3300009784 Bacteria 52582
53 Ga0466705_152632 3300042612 Bacteria 6203
54 Ga0466733_091215 3300042659 Bacteria 7210
55 Ga0466729_285011 3300042621 Bacteria 12342
56 Ga0466703_027253 3300042636 Unclassified 2239
57 Ga0466708_462241 3300042652 Bacteria 17656
58 Ga0466723_056343 3300042618 Bacteria 9755
59 Ga0466728_427407 3300042620 Bacteria 5291
60 Ga0466706_229281 3300042599 Bacteria 1159
61 Ga0466707_373620 3300042601 Bacteria 1834
62 Ga0123355_10000967 3300009826 Bacteria 39727
63 Ga0123355_10010627 3300009826 Bacteria 14135
64 Ga0123355_10028057 3300009826 Bacteria 9098
65 Ga0123355_10041529 3300009826 Bacteria 7488
66 Ga0123355_10490420 3300009826 Bacteria 1522
67 Ga0123355_10704302 3300009826 Bacteria 1158
68 Ga0123355_11435556 3300009826 Bacteria 679
69 Ga0123356_10708346 3300010049 Bacteria 1176
70 Ga0123356_11397979 3300010049 Unclassified 860
71 Ga0123356_12193417 3300010049 Bacteria 690
72 Ga0123353_10152153 3300010167 Unclassified 3692
73 Ga0123353_10282012 3300010167 Bacteria 2551
74 IMNBL1DRAFT_c0027633 3300000062 Bacteria 2129
75 JGI24702J35022_10001954 3300002462 Bacteria 12709
76 Ga0466703_066174 3300042636 Bacteria 1325
77 Ga0466708_150635 3300042652 Bacteria 6168
78 Ga0466710_082239 3300042613 Bacteria 2258
79 Ga0466729_039879 3300042621 Bacteria 1163
80 Ga0466729_170230 3300042621 Bacteria 1758
81 Ga0123355_10118619 3300009826 Bacteria 4111
82 Ga0123355_10252912 3300009826 Bacteria 2477
83 Ga0123356_10096093 3300010049 Bacteria 2833
84 Ga0123356_10828411 3300010049 Bacteria 1096
85 Ga0123356_12624072 3300010049 Bacteria 631
86 Ga0123353_10040321 3300010167 Bacteria 7366
87 Ga0123353_11030368 3300010167 Bacteria 1102
88 Ga0123353_11448926 3300010167 Bacteria 879
89 Ga0123353_13208156 3300010167 Bacteria 524
90 JGI24695J34938_10143786 3300002450 Bacteria 975
91 JGI24702J35022_10000608 3300002462 Bacteria 21719
92 Ga0068302_10219889 3300005071 Bacteria 2080
93 Ga0466734_130063 3300042623 Bacteria 2925
94 Ga0466703_020388 3300042636 Bacteria 11755
95 Ga0466728_014869 3300042620 Unclassified 2188
96 Ga0466690_056298 3300042590 Bacteria 5408
97 Ga0466693_312450 3300042592 Bacteria 1471
98 Ga0466696_184298 3300042596 Bacteria 6328
99 Ga0123357_10125102 3300009784 Bacteria 3224
100 Ga0123355_10003805 3300009826 Bacteria 21817
101 Ga0123355_10028128 3300009826 Bacteria 9089
102 Ga0123355_10098567 3300009826 Bacteria 4609
103 Ga0123355_10847115 3300009826 Bacteria 1007
104 Ga0123355_11602391 3300009826 Bacteria 627
105 Ga0123355_11717849 3300009826 Unclassified 597
106 Ga0123356_10003496 3300010049 Bacteria 16437
107 Ga0123356_10066597 3300010049 Bacteria 3372
108 Ga0123356_10123540 3300010049 Bacteria 2523
109 Ga0123353_10539895 3300010167 Bacteria 1685
110 Ga0123353_10926262 3300010167 Bacteria 1182
111 Ga0123354_10652237 3300010882 Bacteria 751
112 Ga0466733_123746 3300042659 Bacteria 3479
113 Ga0466734_075613 3300042623 Bacteria 1706
114 Ga0466709_393246 3300042648 Bacteria 2275
115 Ga0466727_176279 3300042655 Bacteria 1354
116 Ga0466728_116745 3300042620 Bacteria 4944
117 Ga0466728_231916 3300042620 Bacteria 1201
118 Ga0466714_071144 3300042603 Bacteria 1071
119 Ga0466722_044244 3300042609 Bacteria 4116
120 Ga0123355_10003563 3300009826 Bacteria 22384
121 Ga0123355_10064987 3300009826 Unclassified 5877
122 Ga0123355_10183278 3300009826 Bacteria 3103
123 Ga0123355_10213121 3300009826 Bacteria 2794
124 Ga0123356_10197732 3300010049 Bacteria 2048
125 Ga0123356_10793465 3300010049 Bacteria 1118
126 Ga0123356_11674502 3300010049 Bacteria 789
127 Ga0123353_10193676 3300010167 Bacteria 3206
128 Ga0123353_10607777 3300010167 Bacteria 1561
129 Ga0123353_11831398 3300010167 Bacteria 752
130 Ga0123353_13437416 3300010167 Unclassified 501
131 Ga0466697_125128 3300042611 Bacteria 2669
132 Ga0466705_032059 3300042612 Bacteria 4813
133 Ga0466734_021280 3300042623 Bacteria 1563
134 Ga0466704_417078 3300042643 Bacteria 1121
135 Ga0466715_427132 3300042616 Bacteria 12964
136 Ga0466723_036698 3300042618 Bacteria 5860
137 Ga0466719_158980 3300042606 Bacteria 6638
138 Ga0466721_379530 3300042608 Bacteria 1621
139 Ga0466722_027454 3300042609 Bacteria 32114
140 Ga0123355_10000251 3300009826 Bacteria 69105
141 Ga0123355_10002047 3300009826 Unclassified 28468
142 Ga0123355_10045150 3300009826 Bacteria 7167
143 Ga0123355_10450955 3300009826 Unclassified 1621
144 Ga0123353_10235063 3300010167 Bacteria 2853
145 Ga0123353_10544129 3300010167 Bacteria 1677
146 JGI24702J35022_10060504 3300002462 Bacteria 2025

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789003 2227064010 2227419958 105
2 3300000062 IMNBL1DRAFT_c0027633 IMNBL1DRAFT_00276332 105
3 3300009826 Ga0123355_10064987 Ga0123355_100649872 105
4 3300009826 Ga0123355_10866989 Ga0123355_108669892 105
5 3300009826 Ga0123355_11435556 Ga0123355_114355562 105
6 3300010049 Ga0123356_10096093 Ga0123356_100960932 105
7 3300010049 Ga0123356_11134170 Ga0123356_111341701 105
8 3300010049 Ga0123356_11674502 Ga0123356_116745022 105
9 3300010167 Ga0123353_10544129 Ga0123353_105441293 105
10 3300042596 Ga0466696_129425 Ga0466696_129425_364_681 105
11 3300042596 Ga0466696_184298 Ga0466696_184298_3357_3674 105
12 3300042599 Ga0466706_011673 Ga0466706_011673_1492_1809 105
13 3300042601 Ga0466707_373620 Ga0466707_373620_654_971 105
14 3300042603 Ga0466714_071144 Ga0466714_071144_108_425 105
15 3300042603 Ga0466714_147744 Ga0466714_147744_331_648 105
16 3300042605 Ga0466716_395861 Ga0466716_395861_10005_10322 105
17 3300042606 Ga0466719_158980 Ga0466719_158980_4004_4321 105
18 3300042606 Ga0466719_176669 Ga0466719_176669_2270_2587 105
19 3300042608 Ga0466721_379530 Ga0466721_379530_874_1191 105
20 3300042609 Ga0466722_008569 Ga0466722_008569_918_1235 105
21 3300042609 Ga0466722_027454 Ga0466722_027454_22048_22365 105
22 3300042609 Ga0466722_044244 Ga0466722_044244_73_390 105
23 3300042612 Ga0466705_032059 Ga0466705_032059_2740_3057 105
24 3300042612 Ga0466705_099458 Ga0466705_099458_124_441 105
25 3300042612 Ga0466705_152632 Ga0466705_152632_5746_6063 105
26 3300042616 Ga0466715_086153 Ga0466715_086153_886_1203 105
27 3300042616 Ga0466715_391740 Ga0466715_391740_5701_6018 105
28 3300042616 Ga0466715_427132 Ga0466715_427132_11069_11386 105
29 3300042618 Ga0466723_056343 Ga0466723_056343_7902_8219 105
30 3300042620 Ga0466728_014869 Ga0466728_014869_1699_2016 105
31 3300042620 Ga0466728_231916 Ga0466728_231916_720_1037 105
32 3300042620 Ga0466728_427407 Ga0466728_427407_598_915 105
33 3300042621 Ga0466729_039879 Ga0466729_039879_103_420 105
34 3300042621 Ga0466729_170230 Ga0466729_170230_1185_1502 105
35 3300042621 Ga0466729_285011 Ga0466729_285011_3193_3510 105
36 3300042623 Ga0466734_021280 Ga0466734_021280_668_985 105
37 3300042623 Ga0466734_075613 Ga0466734_075613_681_998 105
38 3300042624 Ga0466735_013196 Ga0466735_013196_874_1191 105
39 3300042636 Ga0466703_020388 Ga0466703_020388_11252_11569 105
40 3300042636 Ga0466703_027253 Ga0466703_027253_540_857 105
41 3300042636 Ga0466703_066174 Ga0466703_066174_46_363 105
42 3300042636 Ga0466703_124909 Ga0466703_124909_2129_2446 105
43 3300042643 Ga0466704_164622 Ga0466704_164622_1574_1891 105
44 3300042643 Ga0466704_417078 Ga0466704_417078_789_1106 105
45 3300042648 Ga0466709_393246 Ga0466709_393246_698_1015 105
46 3300042652 Ga0466708_150635 Ga0466708_150635_3694_4011 105
47 3300042652 Ga0466708_462241 Ga0466708_462241_3729_4046 105
48 3300042654 Ga0466725_372785 Ga0466725_372785_1443_1760 105
49 3300042655 Ga0466727_176279 Ga0466727_176279_662_979 105
50 3300042659 Ga0466733_091215 Ga0466733_091215_4999_5316 105
51 3300042659 Ga0466733_123746 Ga0466733_123746_547_864 105
52 iso_pr_bacteria 2609459943 2610743338 105
53 iso_pr_bacteria 2695420314 2695472707 105
54 iso_pr_bacteria 2781125632 2781269836 105
55 iso_pr_bacteria 2781125685 2781417100 105
56 iso_pr_bacteria 2820220859 2820222835 105
57 iso_pr_bacteria 2820223845 2820225015 105
58 iso_pr_bacteria 2820332331 2820332495 105
59 iso_pr_bacteria 2820483401 2820485175 105
60 iso_pr_bacteria 2820488713 2820490499 105
61 iso_pr_bacteria 2820501819 2820502971 105
62 iso_pr_bacteria 2820533259 2820535357 105
63 iso_pr_bacteria 2820587002 2820588428 105
64 iso_pr_bacteria 2820600392 2820600938 105
65 iso_pr_bacteria 2820617402 2820618045 105
66 iso_pr_bacteria 2820626145 2820627745 105
67 iso_pr_bacteria 2830041218 2830041276 105
68 iso_pr_bacteria 2922326829 2922329660 105
69 iso_pr_bacteria 2940193328 2940194677 105
70 iso_pr_bacteria 2940195863 2940198699 105
71 iso_pr_bacteria 2940199050 2940199335 105
72 iso_pr_bacteria 2940209341 2940210440 105
73 iso_pr_bacteria 2940244548 2940248606 105
74 iso_pr_bacteria 2940248789 2940252784 105
75 iso_pr_bacteria 2940253009 2940257042 105
76 iso_pr_bacteria 2940257232 2940261197 105
77 iso_pr_bacteria 2940336608 2940337923 105
78 iso_pr_bacteria 2940346213 2940346397 105
79 iso_pr_bacteria 3004667792 3004669601 105
80 iso_pr_bacteria 3004672520 3004675960 105
81 3300002450 JGI24695J34938_10006950 JGI24695J34938_100069506 106
82 3300002462 JGI24702J35022_10000608 JGI24702J35022_100006081 106
83 3300002462 JGI24702J35022_10001954 JGI24702J35022_100019545 106
84 3300005071 Ga0068302_10219889 Ga0068302_102198892 106
85 3300009784 Ga0123357_10125102 Ga0123357_101251023 106
86 3300009826 Ga0123355_10000251 Ga0123355_1000025130 106
87 3300009826 Ga0123355_10000293 Ga0123355_1000029337 106
88 3300009826 Ga0123355_10001005 Ga0123355_1000100527 106
89 3300009826 Ga0123355_10003805 Ga0123355_1000380520 106
90 3300009826 Ga0123355_10005031 Ga0123355_1000503112 106
91 3300009826 Ga0123355_10010627 Ga0123355_100106272 106
92 3300009826 Ga0123355_10013944 Ga0123355_1001394413 106
93 3300009826 Ga0123355_10028057 Ga0123355_100280573 106
94 3300009826 Ga0123355_10028128 Ga0123355_100281286 106
95 3300009826 Ga0123355_10041529 Ga0123355_100415293 106
96 3300009826 Ga0123355_10045150 Ga0123355_100451502 106
97 3300009826 Ga0123355_10058764 Ga0123355_100587643 106
98 3300009826 Ga0123355_10089759 Ga0123355_100897593 106
99 3300009826 Ga0123355_10098567 Ga0123355_100985676 106
100 3300009826 Ga0123355_10118619 Ga0123355_101186192 106
101 3300009826 Ga0123355_10167020 Ga0123355_101670202 106
102 3300009826 Ga0123355_10183278 Ga0123355_101832782 106
103 3300009826 Ga0123355_10252912 Ga0123355_102529122 106
104 3300009826 Ga0123355_10450955 Ga0123355_104509552 106
105 3300009826 Ga0123355_10490420 Ga0123355_104904202 106
106 3300009826 Ga0123355_10634639 Ga0123355_106346392 106
107 3300009826 Ga0123355_10744698 Ga0123355_107446982 106
108 3300009826 Ga0123355_10847115 Ga0123355_108471152 106
109 3300009826 Ga0123355_10877815 Ga0123355_108778152 106
110 3300009826 Ga0123355_10898812 Ga0123355_108988122 106
111 3300009826 Ga0123355_11239788 Ga0123355_112397882 106
112 3300009826 Ga0123355_11602391 Ga0123355_116023912 106
113 3300009826 Ga0123355_11717849 Ga0123355_117178493 106
114 3300010049 Ga0123356_10066597 Ga0123356_100665973 106
115 3300010049 Ga0123356_10076237 Ga0123356_100762373 106
116 3300010049 Ga0123356_10197732 Ga0123356_101977322 106
117 3300010049 Ga0123356_10505631 Ga0123356_105056312 106
118 3300010049 Ga0123356_10708346 Ga0123356_107083462 106
119 3300010049 Ga0123356_10793465 Ga0123356_107934651 106
120 3300010049 Ga0123356_10828411 Ga0123356_108284112 106
121 3300010049 Ga0123356_11166873 Ga0123356_111668732 106
122 3300010049 Ga0123356_12624072 Ga0123356_126240721 106
123 3300010049 Ga0123356_12946061 Ga0123356_129460611 106
124 3300010167 Ga0123353_10021459 Ga0123353_100214594 106
125 3300010167 Ga0123353_10133535 Ga0123353_101335353 106
126 3300010167 Ga0123353_10171645 Ga0123353_101716453 106
127 3300010167 Ga0123353_10266766 Ga0123353_102667663 106
128 3300010167 Ga0123353_10282012 Ga0123353_102820121 106
129 3300010167 Ga0123353_10539895 Ga0123353_105398952 106
130 3300010167 Ga0123353_10607777 Ga0123353_106077772 106
131 3300010167 Ga0123353_11017639 Ga0123353_110176392 106
132 3300010167 Ga0123353_11448926 Ga0123353_114489262 106
133 3300010167 Ga0123353_11516405 Ga0123353_115164052 106
134 3300010167 Ga0123353_11831398 Ga0123353_118313982 106
135 3300010167 Ga0123353_13208156 Ga0123353_132081562 106
136 3300042592 Ga0466693_312450 Ga0466693_312450_210_530 106
137 3300042598 Ga0466701_014980 Ga0466701_014980_56_376 106
138 3300042599 Ga0466706_229281 Ga0466706_229281_146_466 106
139 3300042623 Ga0466734_130063 Ga0466734_130063_887_1207 106
140 3300042643 Ga0466704_344304 Ga0466704_344304_4750_5070 106
141 iso_pr_bacteria 2781125666 2781343620 106
142 3300002450 JGI24695J34938_10143786 JGI24695J34938_101437862 107
143 3300002462 JGI24702J35022_10060504 JGI24702J35022_100605042 107
144 3300009784 Ga0123357_10000232 Ga0123357_1000023229 107
145 3300009826 Ga0123355_10000967 Ga0123355_1000096733 107
146 3300009826 Ga0123355_10213121 Ga0123355_102131212 107
147 3300009826 Ga0123355_10704302 Ga0123355_107043022 107
148 3300010049 Ga0123356_10123540 Ga0123356_101235404 107
149 3300010049 Ga0123356_11397979 Ga0123356_113979792 107
150 3300010167 Ga0123353_10040321 Ga0123353_100403214 107
151 3300010167 Ga0123353_10152153 Ga0123353_101521535 107
152 3300010167 Ga0123353_10234432 Ga0123353_102344322 107
153 3300010167 Ga0123353_10681660 Ga0123353_106816602 107
154 3300010167 Ga0123353_10926262 Ga0123353_109262622 107
155 3300010167 Ga0123353_10981199 Ga0123353_109811992 107
156 3300010167 Ga0123353_11030368 Ga0123353_110303681 107
157 3300010167 Ga0123353_11065091 Ga0123353_110650912 107
158 3300010167 Ga0123353_12368975 Ga0123353_123689752 107
159 3300010167 Ga0123353_13437416 Ga0123353_134374161 107
160 3300042620 Ga0466728_116745 Ga0466728_116745_1111_1434 107
161 iso_pr_bacteria 2820693137 2820696111 107
162 3300009826 Ga0123355_10002047 Ga0123355_1000204711 108
163 3300010882 Ga0123354_10652237 Ga0123354_106522372 108
164 3300010049 Ga0123356_12193417 Ga0123356_121934172 109
165 3300042615 Ga0466711_195067 Ga0466711_195067_1117_1446 109
166 3300000062 IMNBL1DRAFT_c0003545 IMNBL1DRAFT_00035455 110
167 3300010049 Ga0123356_11019168 Ga0123356_110191682 110
168 3300010049 Ga0123356_11185006 Ga0123356_111850062 110
169 3300010167 Ga0123353_10235063 Ga0123353_102350632 110
170 3300042590 Ga0466690_056298 Ga0466690_056298_3401_3733 110
171 3300042618 Ga0466723_036698 Ga0466723_036698_2607_2939 110
172 iso_pr_bacteria 2820472365 2820472841 110
173 3300010167 Ga0123353_10730959 Ga0123353_107309592 112
174 3300042613 Ga0466710_082239 Ga0466710_082239_1499_1837 112
175 3300010049 Ga0123356_10003496 Ga0123356_100034964 114
176 3300010167 Ga0123353_10193676 Ga0123353_101936764 116
177 3300042611 Ga0466697_125128 Ga0466697_125128_1661_2047 128
178 3300009826 Ga0123355_10003563 Ga0123355_100035637 131

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14330 DUF4387 Domain of unknown function (DUF4387) 5 101 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.