Protein Family IF09501
Metagenome
Isolate
139
Members
40
Samples
134
Scaffolds
361.03
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_409680|Ga0466704_409680_6534_7706
- Length
- 390 aa
- Sequence
- MYFPAFYLPLEGMGETLSTVYFSVIGVLASYFFILAGANIVEMRRNTLPPAIIDGPLVSVLIPVRNEAAHIENCLTTLMQQGYRNYEILVLDDDSQDTTWAIITKVAQTDSRIRIFSGSPLPDDWYGKSYALQQLAGKARGEILILTDADTVHSPSSISWAVTNMCSSHADFISGYVGQQLRSFGEKITVPLMFFLTGFIIPLCLNRYTRYCFFSAAVGQFIAIRKDVFMHIGGFTMMRNKTSEDMYLARYVKAQGFKTLFLDVGEQVQCRMYTGYKAAVAGIGKNIFDFLGNHSVILVAMLFAVLFFLFLPFPLLCVITLIPRNFQMNLLVVNILYTLTWMMLFIDRKIPWYYGLFWPLMFLNLIAMALWSWFRTISGKGFLWKGRIVR
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
33.3%
Unclassified
15.4%
Termopsidae
7.7%
Rhinotermitidae
2.6%
Blaberidae
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 27 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 30 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_037906 | 3300042612 | Bacteria | 9719 |
| 2 | Ga0466703_131903 | 3300042636 | Bacteria | 1928 |
| 3 | Ga0466704_239055 | 3300042643 | Bacteria | 21412 |
| 4 | Ga0466708_090688 | 3300042652 | Bacteria | 3067 |
| 5 | Ga0466708_457287 | 3300042652 | Unclassified | 1560 |
| 6 | Ga0123356_10000977 | 3300010049 | Bacteria | 31725 |
| 7 | Ga0123356_10069451 | 3300010049 | Bacteria | 3304 |
| 8 | Ga0123356_10269002 | 3300010049 | Bacteria | 1793 |
| 9 | Ga0466696_023950 | 3300042596 | Bacteria | 3809 |
| 10 | Ga0466726_115949 | 3300042619 | Bacteria | 1587 |
| 11 | Ga0466726_187112 | 3300042619 | Bacteria | 5446 |
| 12 | Ga0466726_325755 | 3300042619 | Bacteria | 3658 |
| 13 | Ga0466716_087643 | 3300042605 | Bacteria | 24320 |
| 14 | JGI24698J34947_10037084 | 3300002449 | Bacteria | 2535 |
| 15 | Ga0466705_270069 | 3300042612 | Bacteria | 6166 |
| 16 | Ga0466733_095122 | 3300042659 | Bacteria | 12121 |
| 17 | Ga0466703_368156 | 3300042636 | Bacteria | 6192 |
| 18 | Ga0466704_030782 | 3300042643 | Bacteria | 2179 |
| 19 | Ga0466690_015960 | 3300042590 | Unclassified | 2618 |
| 20 | Ga0466690_154611 | 3300042590 | Bacteria | 8229 |
| 21 | Ga0466723_193953 | 3300042618 | Bacteria | 4702 |
| 22 | Ga0466723_198210 | 3300042618 | Bacteria | 6399 |
| 23 | Ga0466728_103671 | 3300042620 | Bacteria | 14589 |
| 24 | Ga0466707_398574 | 3300042601 | Bacteria | 1438 |
| 25 | Ga0466713_130075 | 3300042602 | Bacteria | 30790 |
| 26 | Ga0466716_451111 | 3300042605 | Bacteria | 4167 |
| 27 | Ga0466719_334025 | 3300042606 | Bacteria | 7146 |
| 28 | JGI24695J34938_10002501 | 3300002450 | Bacteria | 13987 |
| 29 | JGI24702J35022_10000946 | 3300002462 | Bacteria | 18130 |
| 30 | Ga0072941_1002912 | 3300005201 | Bacteria | 12432 |
| 31 | Ga0466705_209009 | 3300042612 | Bacteria | 1997 |
| 32 | Ga0466703_046630 | 3300042636 | Bacteria | 3764 |
| 33 | Ga0466703_226246 | 3300042636 | Unclassified | 2983 |
| 34 | Ga0466704_062181 | 3300042643 | Bacteria | 3591 |
| 35 | Ga0466704_489395 | 3300042643 | Unclassified | 4608 |
| 36 | Ga0466709_005784 | 3300042648 | Bacteria | 3760 |
| 37 | Ga0466709_205851 | 3300042648 | Bacteria | 9866 |
| 38 | Ga0123357_10148422 | 3300009784 | Bacteria | 2854 |
| 39 | Ga0123353_10304127 | 3300010167 | Bacteria | 2432 |
| 40 | Ga0466711_236407 | 3300042615 | Bacteria | 3673 |
| 41 | JGI24695J34938_10000846 | 3300002450 | Bacteria | 28385 |
| 42 | Ga0466705_219720 | 3300042612 | Bacteria | 5207 |
| 43 | Ga0466703_245862 | 3300042636 | Bacteria | 10675 |
| 44 | Ga0466709_085497 | 3300042648 | Unclassified | 1526 |
| 45 | Ga0466696_125269 | 3300042596 | Unclassified | 4714 |
| 46 | Ga0466715_001364 | 3300042616 | Bacteria | 11977 |
| 47 | Ga0466716_068606 | 3300042605 | Bacteria | 1209 |
| 48 | JGI24698J34947_10013738 | 3300002449 | Bacteria | 4411 |
| 49 | JGI24698J34947_10034633 | 3300002449 | Unclassified | 2640 |
| 50 | Ga0466705_148015 | 3300042612 | Bacteria | 6236 |
| 51 | Ga0466705_318573 | 3300042612 | Bacteria | 8813 |
| 52 | Ga0466732_166146 | 3300042656 | Bacteria | 2291 |
| 53 | Ga0466735_001690 | 3300042624 | Bacteria | 2248 |
| 54 | Ga0466704_170637 | 3300042643 | Bacteria | 5682 |
| 55 | Ga0466709_004059 | 3300042648 | Bacteria | 3889 |
| 56 | Ga0466708_059231 | 3300042652 | Bacteria | 2125 |
| 57 | Ga0466727_039206 | 3300042655 | Bacteria | 2962 |
| 58 | Ga0466727_050270 | 3300042655 | Bacteria | 1840 |
| 59 | Ga0123356_10009490 | 3300010049 | Bacteria | 9610 |
| 60 | Ga0466690_155427 | 3300042590 | Bacteria | 1644 |
| 61 | Ga0466696_263273 | 3300042596 | Bacteria | 3255 |
| 62 | Ga0466712_076197 | 3300042614 | Bacteria | 1132 |
| 63 | Ga0466712_197398 | 3300042614 | Bacteria | 4743 |
| 64 | Ga0466711_052757 | 3300042615 | Bacteria | 13222 |
| 65 | Ga0466711_155412 | 3300042615 | Bacteria | 10135 |
| 66 | Ga0466711_206332 | 3300042615 | Bacteria | 3854 |
| 67 | Ga0466715_096286 | 3300042616 | Bacteria | 1935 |
| 68 | Ga0466715_577176 | 3300042616 | Bacteria | 7547 |
| 69 | Ga0466723_022703 | 3300042618 | Bacteria | 9894 |
| 70 | Ga0466723_143506 | 3300042618 | Bacteria | 24267 |
| 71 | Ga0466719_066638 | 3300042606 | Bacteria | 1850 |
| 72 | Ga0466719_576166 | 3300042606 | Bacteria | 2922 |
| 73 | Ga0466698_517054 | 3300042610 | Bacteria | 2101 |
| 74 | JGI24698J34947_10034682 | 3300002449 | Bacteria | 2638 |
| 75 | JGI24698J34947_10073771 | 3300002449 | Bacteria | 1627 |
| 76 | JGI24695J34938_10000245 | 3300002450 | Bacteria | 52223 |
| 77 | Ga0466735_142138 | 3300042624 | Bacteria | 1836 |
| 78 | Ga0466735_232896 | 3300042624 | Bacteria | 2968 |
| 79 | Ga0466703_066674 | 3300042636 | Bacteria | 13204 |
| 80 | Ga0466704_454845 | 3300042643 | Bacteria | 60212 |
| 81 | Ga0466708_036794 | 3300042652 | Bacteria | 6881 |
| 82 | Ga0466708_108361 | 3300042652 | Bacteria | 30243 |
| 83 | Ga0466708_211352 | 3300042652 | Bacteria | 3390 |
| 84 | Ga0123357_10060377 | 3300009784 | Bacteria | 5086 |
| 85 | Ga0466696_184057 | 3300042596 | Bacteria | 30206 |
| 86 | Ga0466712_082916 | 3300042614 | Bacteria | 3004 |
| 87 | Ga0466712_202792 | 3300042614 | Bacteria | 9583 |
| 88 | Ga0466711_061198 | 3300042615 | Bacteria | 8306 |
| 89 | Ga0466711_183350 | 3300042615 | Bacteria | 47393 |
| 90 | Ga0466718_096425 | 3300042617 | Bacteria | 13009 |
| 91 | Ga0466723_207332 | 3300042618 | Bacteria | 6867 |
| 92 | Ga0466728_337476 | 3300042620 | Bacteria | 7074 |
| 93 | Ga0466716_245099 | 3300042605 | Unclassified | 3158 |
| 94 | Ga0466732_019937 | 3300042656 | Bacteria | 24454 |
| 95 | Ga0466735_150637 | 3300042624 | Bacteria | 1338 |
| 96 | Ga0466703_222945 | 3300042636 | Bacteria | 19313 |
| 97 | Ga0466704_409680 | 3300042643 | Bacteria | 10810 |
| 98 | Ga0466709_141905 | 3300042648 | Bacteria | 8632 |
| 99 | Ga0466708_144254 | 3300042652 | Bacteria | 3306 |
| 100 | Ga0466727_155844 | 3300042655 | Bacteria | 2463 |
| 101 | Ga0466727_182386 | 3300042655 | Bacteria | 2169 |
| 102 | Ga0466690_118658 | 3300042590 | Bacteria | 5585 |
| 103 | Ga0466691_025777 | 3300042593 | Bacteria | 3036 |
| 104 | Ga0466691_153114 | 3300042593 | Bacteria | 1915 |
| 105 | Ga0466696_049086 | 3300042596 | Unclassified | 2163 |
| 106 | Ga0466696_070838 | 3300042596 | Unclassified | 2545 |
| 107 | Ga0466699_046462 | 3300042597 | Bacteria | 1283 |
| 108 | Ga0466699_280968 | 3300042597 | Bacteria | 14109 |
| 109 | Ga0466699_390143 | 3300042597 | Bacteria | 3997 |
| 110 | Ga0466705_495001 | 3300042612 | Bacteria | 3523 |
| 111 | Ga0466716_212902 | 3300042605 | Bacteria | 2392 |
| 112 | Ga0466719_244036 | 3300042606 | Bacteria | 18558 |
| 113 | Ga0466720_204347 | 3300042607 | Bacteria | 3554 |
| 114 | JGI24695J34938_10003208 | 3300002450 | Bacteria | 11588 |
| 115 | Ga0466705_077798 | 3300042612 | Bacteria | 3590 |
| 116 | Ga0466705_304580 | 3300042612 | Bacteria | 14051 |
| 117 | Ga0466733_086352 | 3300042659 | Bacteria | 29868 |
| 118 | Ga0466703_010199 | 3300042636 | Bacteria | 14301 |
| 119 | Ga0466709_024382 | 3300042648 | Bacteria | 3800 |
| 120 | Ga0466708_031299 | 3300042652 | Bacteria | 8597 |
| 121 | Ga0466727_255290 | 3300042655 | Bacteria | 1546 |
| 122 | Ga0466727_295671 | 3300042655 | Bacteria | 4031 |
| 123 | Ga0466690_403489 | 3300042590 | Unclassified | 1470 |
| 124 | Ga0466696_340353 | 3300042596 | Bacteria | 1548 |
| 125 | Ga0466696_456573 | 3300042596 | Bacteria | 20856 |
| 126 | Ga0466699_106228 | 3300042597 | Bacteria | 1813 |
| 127 | Ga0466712_080364 | 3300042614 | Bacteria | 2673 |
| 128 | Ga0466718_023747 | 3300042617 | Bacteria | 4288 |
| 129 | Ga0466723_029994 | 3300042618 | Bacteria | 9965 |
| 130 | Ga0466728_049195 | 3300042620 | Bacteria | 9925 |
| 131 | Ga0466728_151650 | 3300042620 | Bacteria | 3657 |
| 132 | Ga0466706_164248 | 3300042599 | Bacteria | 1503 |
| 133 | Ga0466722_132556 | 3300042609 | Bacteria | 3127 |
| 134 | Ga0072941_1091350 | 3300005201 | Bacteria | 3718 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010049 | Ga0123356_10069451 | Ga0123356_100694512 | 310 |
| 2 | 3300042597 | Ga0466699_046462 | Ga0466699_046462_30_1076 | 311 |
| 3 | 3300042620 | Ga0466728_103671 | Ga0466728_103671_10071_11009 | 312 |
| 4 | 3300042648 | Ga0466709_085497 | Ga0466709_085497_343_1389 | 318 |
| 5 | 3300042605 | Ga0466716_068606 | Ga0466716_068606_78_1124 | 324 |
| 6 | 3300042614 | Ga0466712_076197 | Ga0466712_076197_111_1094 | 327 |
| 7 | 3300042636 | Ga0466703_046630 | Ga0466703_046630_882_1928 | 327 |
| 8 | 3300042597 | Ga0466699_106228 | Ga0466699_106228_625_1773 | 332 |
| 9 | 3300042648 | Ga0466709_205851 | Ga0466709_205851_7391_8536 | 332 |
| 10 | 3300042599 | Ga0466706_164248 | Ga0466706_164248_365_1366 | 333 |
| 11 | 3300042655 | Ga0466727_155844 | Ga0466727_155844_517_1572 | 334 |
| 12 | 3300042617 | Ga0466718_023747 | Ga0466718_023747_1635_2783 | 335 |
| 13 | 3300042648 | Ga0466709_024382 | Ga0466709_024382_2313_3461 | 335 |
| 14 | 3300042597 | Ga0466699_390143 | Ga0466699_390143_2869_3969 | 336 |
| 15 | 3300042636 | Ga0466703_368156 | Ga0466703_368156_1005_2135 | 337 |
| 16 | 3300042605 | Ga0466716_451111 | Ga0466716_451111_665_1810 | 338 |
| 17 | 3300042652 | Ga0466708_090688 | Ga0466708_090688_831_1976 | 338 |
| 18 | 3300042606 | Ga0466719_244036 | Ga0466719_244036_11847_12992 | 340 |
| 19 | 3300010167 | Ga0123353_10304127 | Ga0123353_103041273 | 344 |
| 20 | 3300042617 | Ga0466718_096425 | Ga0466718_096425_10468_11616 | 345 |
| 21 | 3300042618 | Ga0466723_029994 | Ga0466723_029994_2406_3551 | 346 |
| 22 | 3300042619 | Ga0466726_187112 | Ga0466726_187112_998_2140 | 346 |
| 23 | 3300042612 | Ga0466705_495001 | Ga0466705_495001_1124_2197 | 347 |
| 24 | 3300042624 | Ga0466735_150637 | Ga0466735_150637_25_1068 | 347 |
| 25 | 3300042655 | Ga0466727_050270 | Ga0466727_050270_728_1825 | 347 |
| 26 | 3300042614 | Ga0466712_197398 | Ga0466712_197398_1324_2472 | 348 |
| 27 | 3300042636 | Ga0466703_226246 | Ga0466703_226246_658_1704 | 348 |
| 28 | 3300002450 | JGI24695J34938_10002501 | JGI24695J34938_100025012 | 349 |
| 29 | 3300042590 | Ga0466690_403489 | Ga0466690_403489_174_1322 | 349 |
| 30 | 3300042593 | Ga0466691_153114 | Ga0466691_153114_501_1646 | 349 |
| 31 | 3300042643 | Ga0466704_239055 | Ga0466704_239055_6030_7178 | 349 |
| 32 | 3300042656 | Ga0466732_019937 | Ga0466732_019937_16566_17714 | 349 |
| 33 | 3300042606 | Ga0466719_334025 | Ga0466719_334025_5396_6544 | 350 |
| 34 | 3300042615 | Ga0466711_052757 | Ga0466711_052757_10886_12034 | 350 |
| 35 | 3300042616 | Ga0466715_001364 | Ga0466715_001364_3791_4939 | 350 |
| 36 | 3300042619 | Ga0466726_115949 | Ga0466726_115949_16_1092 | 350 |
| 37 | 3300042652 | Ga0466708_059231 | Ga0466708_059231_561_1694 | 350 |
| 38 | 3300042614 | Ga0466712_082916 | Ga0466712_082916_983_2083 | 352 |
| 39 | 3300042648 | Ga0466709_004059 | Ga0466709_004059_124_1272 | 352 |
| 40 | 3300042652 | Ga0466708_211352 | Ga0466708_211352_990_2135 | 354 |
| 41 | 3300042614 | Ga0466712_202792 | Ga0466712_202792_1540_2688 | 356 |
| 42 | 3300042656 | Ga0466732_166146 | Ga0466732_166146_767_1915 | 356 |
| 43 | 3300042602 | Ga0466713_130075 | Ga0466713_130075_621_1772 | 357 |
| 44 | 3300042636 | Ga0466703_245862 | Ga0466703_245862_5716_6858 | 357 |
| 45 | 3300042590 | Ga0466690_155427 | Ga0466690_155427_138_1286 | 358 |
| 46 | 3300002449 | JGI24698J34947_10073771 | JGI24698J34947_100737712 | 359 |
| 47 | 3300042601 | Ga0466707_398574 | Ga0466707_398574_109_1254 | 359 |
| 48 | 3300042614 | Ga0466712_080364 | Ga0466712_080364_851_1999 | 359 |
| 49 | 3300002449 | JGI24698J34947_10034633 | JGI24698J34947_100346332 | 360 |
| 50 | 3300042607 | Ga0466720_204347 | Ga0466720_204347_2186_3334 | 360 |
| 51 | 3300042615 | Ga0466711_183350 | Ga0466711_183350_29334_30482 | 360 |
| 52 | 3300042620 | Ga0466728_337476 | Ga0466728_337476_5195_6340 | 360 |
| 53 | 3300042624 | Ga0466735_001690 | Ga0466735_001690_151_1305 | 360 |
| 54 | 3300042643 | Ga0466704_062181 | Ga0466704_062181_1024_2154 | 360 |
| 55 | 3300042655 | Ga0466727_039206 | Ga0466727_039206_943_2115 | 360 |
| 56 | 3300042615 | Ga0466711_155412 | Ga0466711_155412_4090_5211 | 361 |
| 57 | 3300042636 | Ga0466703_010199 | Ga0466703_010199_907_2052 | 361 |
| 58 | 3300042652 | Ga0466708_144254 | Ga0466708_144254_898_2043 | 361 |
| 59 | 3300042612 | Ga0466705_318573 | Ga0466705_318573_1202_2350 | 362 |
| 60 | 3300042643 | Ga0466704_489395 | Ga0466704_489395_129_1277 | 362 |
| 61 | 3300010049 | Ga0123356_10269002 | Ga0123356_102690022 | 363 |
| 62 | 3300042596 | Ga0466696_125269 | Ga0466696_125269_932_2074 | 363 |
| 63 | 3300042612 | Ga0466705_148015 | Ga0466705_148015_1490_2635 | 363 |
| 64 | 3300042618 | Ga0466723_198210 | Ga0466723_198210_63_1193 | 363 |
| 65 | 3300042619 | Ga0466726_325755 | Ga0466726_325755_1253_2398 | 363 |
| 66 | 3300042655 | Ga0466727_295671 | Ga0466727_295671_183_1328 | 363 |
| 67 | 3300002450 | JGI24695J34938_10000245 | JGI24695J34938_1000024525 | 364 |
| 68 | 3300002450 | JGI24695J34938_10000846 | JGI24695J34938_1000084610 | 364 |
| 69 | 3300042590 | Ga0466690_118658 | Ga0466690_118658_2311_3459 | 364 |
| 70 | 3300042615 | Ga0466711_061198 | Ga0466711_061198_3953_5098 | 364 |
| 71 | 3300042643 | Ga0466704_454845 | Ga0466704_454845_36880_38028 | 364 |
| 72 | 3300002462 | JGI24702J35022_10000946 | JGI24702J35022_100009462 | 365 |
| 73 | 3300042593 | Ga0466691_025777 | Ga0466691_025777_733_1881 | 365 |
| 74 | 3300042612 | Ga0466705_037906 | Ga0466705_037906_7850_8998 | 365 |
| 75 | 3300042612 | Ga0466705_209009 | Ga0466705_209009_19_1149 | 365 |
| 76 | 3300042612 | Ga0466705_219720 | Ga0466705_219720_411_1559 | 365 |
| 77 | 3300042636 | Ga0466703_222945 | Ga0466703_222945_12467_13615 | 365 |
| 78 | 3300042596 | Ga0466696_023950 | Ga0466696_023950_108_1256 | 366 |
| 79 | 3300042597 | Ga0466699_280968 | Ga0466699_280968_11256_12404 | 366 |
| 80 | 3300042606 | Ga0466719_066638 | Ga0466719_066638_166_1311 | 366 |
| 81 | 3300042648 | Ga0466709_005784 | Ga0466709_005784_125_1270 | 366 |
| 82 | 3300002450 | JGI24695J34938_10003208 | JGI24695J34938_100032084 | 367 |
| 83 | 3300009784 | Ga0123357_10148422 | Ga0123357_101484222 | 367 |
| 84 | 3300010049 | Ga0123356_10009490 | Ga0123356_100094904 | 367 |
| 85 | 3300042618 | Ga0466723_022703 | Ga0466723_022703_5404_6552 | 367 |
| 86 | 3300042620 | Ga0466728_151650 | Ga0466728_151650_1846_2994 | 367 |
| 87 | 3300042596 | Ga0466696_456573 | Ga0466696_456573_6622_7770 | 368 |
| 88 | 3300042606 | Ga0466719_576166 | Ga0466719_576166_71_1219 | 368 |
| 89 | 3300042618 | Ga0466723_207332 | Ga0466723_207332_3808_4956 | 368 |
| 90 | 3300042624 | Ga0466735_232896 | Ga0466735_232896_501_1649 | 368 |
| 91 | 3300042652 | Ga0466708_108361 | Ga0466708_108361_8881_10029 | 368 |
| 92 | 3300042655 | Ga0466727_255290 | Ga0466727_255290_153_1295 | 368 |
| 93 | 3300002449 | JGI24698J34947_10034682 | JGI24698J34947_100346822 | 369 |
| 94 | 3300042596 | Ga0466696_070838 | Ga0466696_070838_1002_2147 | 369 |
| 95 | 3300042596 | Ga0466696_263273 | Ga0466696_263273_950_2098 | 369 |
| 96 | 3300042605 | Ga0466716_087643 | Ga0466716_087643_21257_22402 | 369 |
| 97 | 3300042605 | Ga0466716_212902 | Ga0466716_212902_290_1438 | 369 |
| 98 | 3300042618 | Ga0466723_193953 | Ga0466723_193953_1148_2296 | 369 |
| 99 | 3300042620 | Ga0466728_049195 | Ga0466728_049195_3599_4747 | 369 |
| 100 | 3300042643 | Ga0466704_170637 | Ga0466704_170637_780_1925 | 369 |
| 101 | 3300042652 | Ga0466708_036794 | Ga0466708_036794_4484_5629 | 369 |
| 102 | 3300042659 | Ga0466733_086352 | Ga0466733_086352_27087_28223 | 370 |
| 103 | 3300042615 | Ga0466711_206332 | Ga0466711_206332_2252_3400 | 371 |
| 104 | 3300042615 | Ga0466711_236407 | Ga0466711_236407_1636_2784 | 371 |
| 105 | 3300042648 | Ga0466709_141905 | Ga0466709_141905_6324_7472 | 371 |
| 106 | 3300002449 | JGI24698J34947_10037084 | JGI24698J34947_100370842 | 372 |
| 107 | 3300042610 | Ga0466698_517054 | Ga0466698_517054_654_1811 | 372 |
| 108 | 3300042652 | Ga0466708_031299 | Ga0466708_031299_5356_6504 | 372 |
| 109 | 3300010049 | Ga0123356_10000977 | Ga0123356_1000097718 | 373 |
| 110 | 3300042616 | Ga0466715_577176 | Ga0466715_577176_3129_4274 | 373 |
| 111 | 3300042643 | Ga0466704_030782 | Ga0466704_030782_487_1635 | 373 |
| 112 | 3300042655 | Ga0466727_182386 | Ga0466727_182386_570_1715 | 373 |
| 113 | 3300005201 | Ga0072941_1091350 | Ga0072941_10913503 | 376 |
| 114 | 3300042612 | Ga0466705_077798 | Ga0466705_077798_1595_2725 | 376 |
| 115 | 3300042590 | Ga0466690_154611 | Ga0466690_154611_2353_3486 | 377 |
| 116 | 3300005201 | Ga0072941_1002912 | Ga0072941_100291211 | 378 |
| 117 | 3300042659 | Ga0466733_095122 | Ga0466733_095122_9165_10301 | 378 |
| 118 | 3300042636 | Ga0466703_066674 | Ga0466703_066674_849_2042 | 379 |
| 119 | 3300042596 | Ga0466696_049086 | Ga0466696_049086_917_2059 | 380 |
| 120 | 3300042596 | Ga0466696_184057 | Ga0466696_184057_1256_2398 | 380 |
| 121 | 3300042618 | Ga0466723_143506 | Ga0466723_143506_15227_16369 | 380 |
| 122 | 3300042636 | Ga0466703_131903 | Ga0466703_131903_363_1505 | 380 |
| 123 | 3300042590 | Ga0466690_015960 | Ga0466690_015960_454_1599 | 381 |
| 124 | 3300042605 | Ga0466716_245099 | Ga0466716_245099_1621_2766 | 381 |
| 125 | 3300042612 | Ga0466705_270069 | Ga0466705_270069_4845_5990 | 381 |
| 126 | 3300042652 | Ga0466708_457287 | Ga0466708_457287_388_1533 | 381 |
| 127 | iso_pr_bacteria | 2772190975 | 2773722104 | 381 |
| 128 | 3300009784 | Ga0123357_10060377 | Ga0123357_100603774 | 382 |
| 129 | 3300042596 | Ga0466696_340353 | Ga0466696_340353_232_1380 | 382 |
| 130 | 3300042624 | Ga0466735_142138 | Ga0466735_142138_21_1169 | 382 |
| 131 | iso_pr_bacteria | 2781125665 | 2781342372 | 382 |
| 132 | iso_pr_bacteria | 2781125683 | 2781410916 | 382 |
| 133 | iso_pr_bacteria | 650716102 | 650881396 | 382 |
| 134 | 3300042609 | Ga0466722_132556 | Ga0466722_132556_1123_2274 | 383 |
| 135 | iso_pr_bacteria | 2781125641 | 2781290110 | 383 |
| 136 | 3300002449 | JGI24698J34947_10013738 | JGI24698J34947_100137382 | 384 |
| 137 | 3300042616 | Ga0466715_096286 | Ga0466715_096286_561_1724 | 387 |
| 138 | 3300042612 | Ga0466705_304580 | Ga0466705_304580_7495_8667 | 390 |
| 139 | 3300042643 | Ga0466704_409680 | Ga0466704_409680_6534_7706 | 390 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13641 | Glyco_tranf_2_3 | Glycosyltransferase like family 2 | 58 | 262 | 0.83 |
| PF00535 | Glycos_transf_2 | Glycosyl transferase family 2 | 59 | 229 | 0.82 |
| PF13506 | Glyco_transf_21 | Glycosyl transferase family 21 | 128 | 271 | 0.81 |
| PF10111 | Glyco_tranf_2_2 | Glycosyltransferase like family 2 | 59 | 246 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13506 | GO:0016757 | glycosyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.