Protein Family IF09490

Metagenome Isolate
133 Members
32 Samples
127 Scaffolds
190.44 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_370048|Ga0466704_370048_6273_6917
Length
214 aa
Sequence
MMNAKTPEPWCSGKKYKEYQMMIRYRSMFLLMLCAVMAFAACNQQGQSAPPASSVAAEDEAGFEEFPLGDDFELGPLNVAGVYFQPVDMLPSGQGLAAADSDVHLEADISALENELGYGVGDFVPNLTVDYEISQANGWRSEGTFMPMNASDGPHYGANLKLNGIGQYKIRFIIQNPEAQGYVLHVDQETGVNGRFWGQPLVAEWDFTYPGPSW

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Unclassified 18.8%
Apidae 18.8%
Termopsidae 9.4%
Rhinotermitidae 9.4%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
4 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
7 3300000462 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 Metagenome Apidae
8 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
9 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
10 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
11 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
12 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
15 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300000459 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 Metagenome Apidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 2515154034 Frischella perrara PEB0191 Isolate Apidae
26 2630968947 Frischella perrara PEB0191 Isolate Apidae
27 650716102 Treponema primitia ZAS-2 Isolate Unclassified
28 2833532623 Frischella perrara ESL0167 Isolate Apidae
29 2684622921 Frischella perrara Fp_167 Isolate Unclassified
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_236372 3300042601 Bacteria 1068
2 Ga0466722_008070 3300042609 Bacteria 1715
3 Ga0466722_127758 3300042609 Bacteria 4874
4 Ga0466692_045098 3300042591 Bacteria 3539
5 Ga0466691_026108 3300042593 Bacteria 6547
6 Ga0466703_128055 3300042636 Bacteria 2313
7 Ga0466727_270780 3300042655 Bacteria 3188
8 Ga0466715_280362 3300042616 Bacteria 21006
9 Ga0466723_043161 3300042618 Bacteria 40432
10 Ga0466726_240676 3300042619 Bacteria 2668
11 Ga0466726_313224 3300042619 Bacteria 1781
12 Ga0466726_373851 3300042619 Bacteria 3534
13 Ga0466707_254191 3300042601 Bacteria 1273
14 Ga0466722_075132 3300042609 Bacteria 3604
15 Ga0466722_161470 3300042609 Bacteria 1446
16 Ga0456237_0008102 3300041968 Unclassified 1600
17 Ga0466696_268944 3300042596 Unclassified 1351
18 Ga0466705_099296 3300042612 Bacteria 9598
19 Ga0466705_174586 3300042612 Bacteria 1647
20 Ga0466703_031112 3300042636 Bacteria 9713
21 Ga0466709_008067 3300042648 Unclassified 1478
22 Ga0466709_212217 3300042648 Bacteria 2410
23 Ga0466708_116236 3300042652 Bacteria 5532
24 Ga0466708_357944 3300042652 Bacteria 10282
25 Ga0466727_315186 3300042655 Unclassified 1612
26 Ga0466715_103386 3300042616 Bacteria 15655
27 Ga0466715_479288 3300042616 Bacteria 6429
28 Ga0466726_281750 3300042619 Bacteria 1213
29 Ga0466726_483486 3300042619 Bacteria 1688
30 Ga0466713_049193 3300042602 Bacteria 8390
31 Ga0466719_184641 3300042606 Bacteria 1017
32 Ga0466692_008460 3300042591 Bacteria 9827
33 Ga0466705_035165 3300042612 Bacteria 12506
34 Ga0466703_259145 3300042636 Bacteria 15559
35 Ga0466704_279926 3300042643 Bacteria 5444
36 Ga0466708_082327 3300042652 Bacteria 12850
37 Ga0466708_297671 3300042652 Bacteria 9014
38 Ga0466727_120953 3300042655 Bacteria 3293
39 Ga0466727_192343 3300042655 Bacteria 19086
40 Ga0466715_001281 3300042616 Bacteria 15032
41 Ga0466723_226308 3300042618 Unclassified 1445
42 Ga0466723_330406 3300042618 Bacteria 9779
43 Ga0466726_103420 3300042619 Bacteria 1236
44 Ga0068305_10929249 3300005083 Bacteria 1323
45 Ga0466719_053476 3300042606 Bacteria 9871
46 Ga0466690_295172 3300042590 Bacteria 1451
47 Ga0466692_163004 3300042591 Bacteria 30267
48 Ga0466691_174787 3300042593 Bacteria 1218
49 Ga0466704_114903 3300042643 Bacteria 80354
50 Ga0466704_336668 3300042643 Bacteria 17570
51 Ga0466709_049719 3300042648 Bacteria 5022
52 Ga0466727_100431 3300042655 Unclassified 1890
53 Ga0466727_127224 3300042655 Unclassified 2152
54 Ga0466727_240459 3300042655 Unclassified 5932
55 Ga0466715_595157 3300042616 Bacteria 7827
56 Ga0466723_061814 3300042618 Bacteria 8769
57 Ga0466726_036925 3300042619 Bacteria 1559
58 Ga0466726_092528 3300042619 Bacteria 1239
59 Ga0466726_117753 3300042619 Bacteria 7555
60 Ga0466726_217599 3300042619 Bacteria 5221
61 Ga0466726_364998 3300042619 Bacteria 1977
62 Ga0466726_391765 3300042619 Unclassified 1290
63 SCG598I22_12470 3300000462 Bacteria 23937
64 Ga0466713_014444 3300042602 Bacteria 5628
65 Ga0466719_155164 3300042606 Unclassified 2211
66 Ga0466722_159062 3300042609 Bacteria 2247
67 Ga0466692_037659 3300042591 Bacteria 1684
68 Ga0466692_190589 3300042591 Bacteria 2121
69 Ga0466692_193888 3300042591 Bacteria 1556
70 Ga0466696_063197 3300042596 Bacteria 2815
71 Ga0466709_219292 3300042648 Bacteria 7822
72 Ga0466709_270450 3300042648 Bacteria 23228
73 Ga0466708_025466 3300042652 Bacteria 3803
74 Ga0466711_039057 3300042615 Bacteria 8217
75 Ga0466711_211696 3300042615 Bacteria 1120
76 Ga0466711_309377 3300042615 Bacteria 15596
77 Ga0466726_486954 3300042619 Bacteria 11120
78 Ga0466728_469848 3300042620 Bacteria 2812
79 SCG598C04_11379 3300000459 Unclassified 20627
80 Ga0466713_052964 3300042602 Bacteria 1189
81 Ga0466716_367105 3300042605 Bacteria 4973
82 Ga0466719_354697 3300042606 Bacteria 16235
83 Ga0466719_490911 3300042606 Bacteria 1178
84 Ga0466722_082738 3300042609 Bacteria 2577
85 Ga0466690_078600 3300042590 Bacteria 6937
86 Ga0466692_201330 3300042591 Unclassified 2522
87 Ga0466691_148496 3300042593 Bacteria 39094
88 Ga0466691_170448 3300042593 Bacteria 9798
89 Ga0466727_350843 3300042655 Bacteria 4433
90 Ga0466703_319980 3300042636 Bacteria 22455
91 Ga0466723_095111 3300042618 Bacteria 1252
92 Ga0466723_118249 3300042618 Bacteria 3834
93 Ga0466726_297039 3300042619 Unclassified 11774
94 Ga0466728_101966 3300042620 Bacteria 40822
95 Ga0466707_213979 3300042601 Bacteria 1118
96 Ga0466716_288822 3300042605 Bacteria 3332
97 Ga0466722_195965 3300042609 Bacteria 1544
98 Ga0466692_197297 3300042591 Unclassified 1088
99 Ga0466691_217449 3300042593 Bacteria 9384
100 Ga0466705_221390 3300042612 Unclassified 1319
101 Ga0466705_225447 3300042612 Bacteria 1282
102 Ga0466735_086070 3300042624 Bacteria 1380
103 Ga0466704_370048 3300042643 Bacteria 14256
104 Ga0466708_277901 3300042652 Bacteria 8331
105 Ga0466727_235718 3300042655 Bacteria 2208
106 Ga0466715_582572 3300042616 Bacteria 4469
107 Ga0466723_041068 3300042618 Bacteria 7734
108 Ga0466723_195905 3300042618 Bacteria 1191
109 Ga0466726_099625 3300042619 Bacteria 4542
110 Ga0466726_174549 3300042619 Bacteria 1078
111 gam1t_NODE_110906_length=43291_GC=33_7_Contigs=2 2189573031 Unclassified 43301
112 Ga0466707_013814 3300042601 Bacteria 1040
113 Ga0466713_122427 3300042602 Bacteria 12572
114 Ga0466716_195947 3300042605 Bacteria 29935
115 Ga0466719_113060 3300042606 Bacteria 20304
116 Ga0466722_154020 3300042609 Bacteria 4212
117 Ga0456237_0005240 3300041968 Unclassified 2059
118 Ga0466692_082074 3300042591 Bacteria 16594
119 Ga0466696_010718 3300042596 Bacteria 2215
120 Ga0466705_108381 3300042612 Bacteria 12796
121 Ga0466705_234441 3300042612 Bacteria 11959
122 Ga0466735_012246 3300042624 Bacteria 4979
123 Ga0466703_062487 3300042636 Bacteria 7046
124 Ga0466727_324268 3300042655 Bacteria 1268
125 Ga0466726_138251 3300042619 Bacteria 2024
126 Ga0466726_360797 3300042619 Bacteria 1141
127 Ga0466728_114086 3300042620 Bacteria 27635

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_174586 Ga0466705_174586_17_508 163
2 3300042593 Ga0466691_174787 Ga0466691_174787_41_625 167
3 3300042601 Ga0466707_213979 Ga0466707_213979_104_706 170
4 3300042615 Ga0466711_211696 Ga0466711_211696_315_908 172
5 3300042620 Ga0466728_101966 Ga0466728_101966_4910_5497 172
6 3300042601 Ga0466707_254191 Ga0466707_254191_179_760 173
7 3300042602 Ga0466713_122427 Ga0466713_122427_8396_8917 173
8 3300042648 Ga0466709_219292 Ga0466709_219292_1155_1742 173
9 3300042605 Ga0466716_367105 Ga0466716_367105_534_1121 174
10 3300042606 Ga0466719_354697 Ga0466719_354697_9486_10073 174
11 3300042618 Ga0466723_043161 Ga0466723_043161_5150_5737 174
12 3300042619 Ga0466726_391765 Ga0466726_391765_197_781 174
13 3300042606 Ga0466719_155164 Ga0466719_155164_377_973 175
14 3300042618 Ga0466723_330406 Ga0466723_330406_6680_7270 175
15 3300042619 Ga0466726_360797 Ga0466726_360797_86_676 175
16 3300042636 Ga0466703_259145 Ga0466703_259145_5115_5702 175
17 3300042643 Ga0466704_114903 Ga0466704_114903_32826_33413 175
18 3300042652 Ga0466708_082327 Ga0466708_082327_8560_9153 175
19 3300042643 Ga0466704_279926 Ga0466704_279926_167_751 176
20 3300042593 Ga0466691_148496 Ga0466691_148496_11501_12088 178
21 3300042609 Ga0466722_159062 Ga0466722_159062_1147_1692 181
22 3300042655 Ga0466727_127224 Ga0466727_127224_166_750 181
23 3300042655 Ga0466727_324268 Ga0466727_324268_308_889 181
24 3300042616 Ga0466715_280362 Ga0466715_280362_8521_9123 182
25 3300042643 Ga0466704_336668 Ga0466704_336668_6401_6952 183
26 3300042606 Ga0466719_184641 Ga0466719_184641_409_1005 184
27 3300042612 Ga0466705_099296 Ga0466705_099296_1891_2445 184
28 3300042652 Ga0466708_025466 Ga0466708_025466_395_976 184
29 3300042624 Ga0466735_012246 Ga0466735_012246_4082_4642 186
30 2189573031 gam1t_NODE_110906_length=43291_GC=33_7_Contigs=2 gam1t_00026090 187
31 3300042609 Ga0466722_154020 Ga0466722_154020_1525_2118 187
32 iso_pr_bacteria 2515154034 2515299531 187
33 iso_pr_bacteria 2630968947 2633886378 187
34 iso_pr_bacteria 2684622921 2686090972 187
35 iso_pr_bacteria 2756170266 2756754208 187
36 iso_pr_bacteria 2833532623 2833533439 187
37 3300000459 SCG598C04_11379 SCG598C04_1137920 188
38 3300000462 SCG598I22_12470 SCG598I22_124706 188
39 3300042619 Ga0466726_217599 Ga0466726_217599_4211_4825 188
40 3300042619 Ga0466726_297039 Ga0466726_297039_969_1583 188
41 3300005083 Ga0068305_10929249 Ga0068305_109292492 189
42 3300042655 Ga0466727_192343 Ga0466727_192343_9445_10014 189
43 3300041968 Ga0456237_0005240 Ga0456237_0005240_25_597 190
44 3300041968 Ga0456237_0008102 Ga0456237_0008102_1011_1583 190
45 3300042602 Ga0466713_014444 Ga0466713_014444_3567_4139 190
46 3300042606 Ga0466719_490911 Ga0466719_490911_579_1151 190
47 3300042619 Ga0466726_281750 Ga0466726_281750_494_1066 190
48 3300042615 Ga0466711_039057 Ga0466711_039057_5565_6158 191
49 3300042616 Ga0466715_595157 Ga0466715_595157_2378_2974 191
50 3300042602 Ga0466713_052964 Ga0466713_052964_473_1051 192
51 3300042605 Ga0466716_288822 Ga0466716_288822_308_886 192
52 3300042609 Ga0466722_075132 Ga0466722_075132_2448_3026 192
53 3300042609 Ga0466722_082738 Ga0466722_082738_1140_1718 192
54 3300042609 Ga0466722_127758 Ga0466722_127758_405_983 192
55 3300042609 Ga0466722_195965 Ga0466722_195965_176_754 192
56 3300042615 Ga0466711_309377 Ga0466711_309377_1809_2387 192
57 3300042616 Ga0466715_103386 Ga0466715_103386_10872_11450 192
58 3300042618 Ga0466723_118249 Ga0466723_118249_1479_2057 192
59 3300042619 Ga0466726_138251 Ga0466726_138251_552_1130 192
60 3300042619 Ga0466726_240676 Ga0466726_240676_1296_1874 192
61 3300042636 Ga0466703_031112 Ga0466703_031112_7145_7723 192
62 3300042636 Ga0466703_128055 Ga0466703_128055_1527_2105 192
63 3300042648 Ga0466709_008067 Ga0466709_008067_307_885 192
64 3300042652 Ga0466708_277901 Ga0466708_277901_644_1222 192
65 3300042652 Ga0466708_297671 Ga0466708_297671_3287_3865 192
66 3300042655 Ga0466727_100431 Ga0466727_100431_369_947 192
67 3300042655 Ga0466727_270780 Ga0466727_270780_861_1439 192
68 3300042655 Ga0466727_315186 Ga0466727_315186_977_1555 192
69 3300042591 Ga0466692_082074 Ga0466692_082074_12834_13415 193
70 3300042591 Ga0466692_193888 Ga0466692_193888_563_1144 193
71 3300042591 Ga0466692_201330 Ga0466692_201330_1503_2084 193
72 3300042593 Ga0466691_217449 Ga0466691_217449_6695_7276 193
73 3300042601 Ga0466707_236372 Ga0466707_236372_419_1000 193
74 3300042602 Ga0466713_049193 Ga0466713_049193_1800_2381 193
75 3300042605 Ga0466716_195947 Ga0466716_195947_1880_2461 193
76 3300042606 Ga0466719_053476 Ga0466719_053476_1602_2183 193
77 3300042616 Ga0466715_001281 Ga0466715_001281_5031_5612 193
78 3300042619 Ga0466726_036925 Ga0466726_036925_383_964 193
79 3300042619 Ga0466726_092528 Ga0466726_092528_157_738 193
80 3300042619 Ga0466726_117753 Ga0466726_117753_2093_2674 193
81 3300042619 Ga0466726_313224 Ga0466726_313224_297_878 193
82 3300042619 Ga0466726_483486 Ga0466726_483486_530_1111 193
83 3300042624 Ga0466735_086070 Ga0466735_086070_742_1323 193
84 3300042652 Ga0466708_357944 Ga0466708_357944_6357_6938 193
85 iso_pr_bacteria 650716102 650883240 193
86 3300042590 Ga0466690_078600 Ga0466690_078600_4600_5184 194
87 3300042591 Ga0466692_008460 Ga0466692_008460_9106_9690 194
88 3300042591 Ga0466692_163004 Ga0466692_163004_20128_20712 194
89 3300042601 Ga0466707_013814 Ga0466707_013814_202_786 194
90 3300042609 Ga0466722_161470 Ga0466722_161470_768_1352 194
91 3300042618 Ga0466723_226308 Ga0466723_226308_737_1321 194
92 3300042619 Ga0466726_099625 Ga0466726_099625_3341_3925 194
93 3300042619 Ga0466726_103420 Ga0466726_103420_193_777 194
94 3300042619 Ga0466726_174549 Ga0466726_174549_212_796 194
95 3300042619 Ga0466726_486954 Ga0466726_486954_1085_1669 194
96 3300042652 Ga0466708_116236 Ga0466708_116236_3579_4163 194
97 3300042655 Ga0466727_120953 Ga0466727_120953_1842_2426 194
98 3300042655 Ga0466727_235718 Ga0466727_235718_125_709 194
99 3300042655 Ga0466727_350843 Ga0466727_350843_3221_3805 194
100 3300042612 Ga0466705_035165 Ga0466705_035165_5558_6145 195
101 3300042619 Ga0466726_364998 Ga0466726_364998_1210_1797 195
102 3300042619 Ga0466726_373851 Ga0466726_373851_1415_2002 195
103 3300042655 Ga0466727_240459 Ga0466727_240459_1053_1640 195
104 3300042591 Ga0466692_197297 Ga0466692_197297_122_712 196
105 3300042596 Ga0466696_010718 Ga0466696_010718_1106_1696 196
106 3300042596 Ga0466696_268944 Ga0466696_268944_651_1241 196
107 3300042612 Ga0466705_221390 Ga0466705_221390_340_930 196
108 3300042612 Ga0466705_225447 Ga0466705_225447_303_893 196
109 3300042618 Ga0466723_041068 Ga0466723_041068_5838_6428 196
110 3300042636 Ga0466703_062487 Ga0466703_062487_5745_6335 196
111 3300042591 Ga0466692_190589 Ga0466692_190589_470_1063 197
112 3300042596 Ga0466696_063197 Ga0466696_063197_114_707 197
113 3300042609 Ga0466722_008070 Ga0466722_008070_429_1022 197
114 3300042612 Ga0466705_234441 Ga0466705_234441_7935_8528 197
115 3300042618 Ga0466723_095111 Ga0466723_095111_590_1186 198
116 3300042618 Ga0466723_195905 Ga0466723_195905_529_1125 198
117 3300042648 Ga0466709_270450 Ga0466709_270450_20740_21336 198
118 3300042591 Ga0466692_037659 Ga0466692_037659_524_1123 199
119 3300042590 Ga0466690_295172 Ga0466690_295172_325_927 200
120 3300042591 Ga0466692_045098 Ga0466692_045098_2602_3204 200
121 3300042593 Ga0466691_026108 Ga0466691_026108_793_1395 200
122 3300042648 Ga0466709_049719 Ga0466709_049719_2030_2632 200
123 3300042606 Ga0466719_113060 Ga0466719_113060_1621_2226 201
124 3300042616 Ga0466715_479288 Ga0466715_479288_1648_2253 201
125 3300042636 Ga0466703_319980 Ga0466703_319980_7940_8545 201
126 3300042593 Ga0466691_170448 Ga0466691_170448_2585_3193 202
127 3300042616 Ga0466715_582572 Ga0466715_582572_3188_3796 202
128 3300042620 Ga0466728_114086 Ga0466728_114086_6206_6817 203
129 3300042620 Ga0466728_469848 Ga0466728_469848_111_722 203
130 3300042648 Ga0466709_212217 Ga0466709_212217_1710_2342 210
131 3300042643 Ga0466704_370048 Ga0466704_370048_6273_6917 214
132 3300042612 Ga0466705_108381 Ga0466705_108381_5106_5843 216
133 3300042618 Ga0466723_061814 Ga0466723_061814_3032_3688 218

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10634 Iron_transport Fe2+ transport protein 63 211 0.97

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
5i0x-assembly1.cif.gz_A COPPER-BOUND M90I VARIANT OF UROPATHOGENIC ESCHERICHIA COLI STRAIN F11 FETP 0.876 62 213
3nrq-assembly1.cif.gz_A Crystal structure of copper-reconstituted FetP from uropathogenic Escherichia coli strain F11 0.874 64 213
6wed-assembly1.cif.gz_B Copper-bound E44Q variant of Campylobacter jejuni P19 0.869 64 211
2o6c-assembly1.cif.gz_B Structure of selenomethionyl rTp34 from Treponema pallidum 0.868 64 214
6wee-assembly1.cif.gz_A Copper-bound M88I variant of Campylobacter jejuni P19 0.868 64 211
IDDescriptionScoreStartEndSuperfamily
3nrpB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.8626 62 213 2.60.40.2480
2o6cB00 Mainly Beta;Sandwich;Immunoglobulin-like;Periplasmic metal-binding protein Tp34-type 0.851 64 214 2.60.40.2480
af_U4PBJ9_364_449_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7255 122 172 2.60.40.10
3uc2D00 Mainly Beta;Sandwich;Immunoglobulin-like;Domain of unknown function DUF4426 0.7002 69 213 2.60.40.3340
5z1aA04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6892 104 206 2.60.40.10
IDDescriptionScoreStartEndGO Terms
AF-W1YWF7-F1-model_v4 Uncharacterized/unreviewed 0.9058 101 211
AF-A0A3E2BWX1-F1-model_v4 Uncharacterized/unreviewed 0.9051 99 214

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.