Protein Family IF09489

Metagenome Isolate
280 Members
222 Samples
95 Scaffolds
247.68 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_368293|Ga0466704_368293_1286_2152
Length
288 aa
Sequence
VTPPAFPRSAGEGGPAGPEEGVHLAATNRRKNLCFLSPDEKPVKVGLFIPCYVNALHPEAGVAAYRLLEHFGVDVDYPLAQTCCGQAMANGGFESEALPLACRFDRLFRSCDYIVAPSASCVAFVREKYPEMLAKDARPCLGGGRIYELCEFLYDVLEVGEMPGHFPHKVSVHNSCHGVRGLRLSSGSELMIPRYSRIIDLLSRVDGIEILEPRRPDECCGFGGMFAVEEAAVSVCMGEDKIRNHLATGAKVVTGADSACLMHMQGIAQRERLPLRFLHVAQILAAGL

📊 Sample Types

Isolate 66.1%
Metagenome 33.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 32.0%
Apidae 19.2%
Drosophilidae 16.9%
Blattidae 8.2%
Unclassified 6.4%
Kalotermitidae 5.9%
Rhinotermitidae 1.8%
Termopsidae 1.8%
Termitidae 1.4%
Berytidae 0.9%
Hydrophilidae 0.9%
Elmidae 0.9%
Culicidae 0.5%
Nymphalidae 0.5%
Passalidae 0.5%
Armadillidiidae 0.5%
Hodotermitidae 0.5%
Alydidae 0.5%
Tenebrionidae 0.5%
Tephritidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 275
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
2 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
3 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
4 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
5 2834143536 Parasaccharibacter apium AS1 Isolate Apidae
6 2834160066 Parasaccharibacter apium B8 Isolate Apidae
7 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
8 2899194184 Bombella sp. ESL0378 Isolate Apidae
9 2920413932 Bombella sp. ESL0380 Isolate Apidae
10 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
11 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
12 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
13 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
14 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
15 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
16 8067594896 Gluconobacter kondonii Dm-18 Isolate Drosophilidae
17 8074745029 Commensalibacter melissae M0407 Isolate Apidae
18 8074748739 Commensalibacter sp. W8133 Isolate Apidae
19 8100531325 Gluconobacter sp. Dm-73 Isolate Drosophilidae
20 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
21 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
22 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
23 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
24 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
25 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 3004672520 Bacteroides sp. 51 Isolate Blattidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
32 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
33 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
34 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
35 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
36 2832298047 Apibacter sp. wkB309 Isolate Apidae
37 2839192570 Gluconobacter sp. DsW_056 Isolate Drosophilidae
38 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
39 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
40 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
41 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
42 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
43 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
44 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
45 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
46 8069748016 Caballeronia sp. LP003 Isolate Coreidae
47 8074832014 Commensalibacter melissae M0391 Isolate Apidae
48 8074875073 Commensalibacter sp. M0265 Isolate Apidae
49 8074878724 Commensalibacter sp. M0267 Isolate Apidae
50 8074880551 Commensalibacter sp. M0268 Isolate Apidae
51 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
52 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
53 8102109360 Caballeronia sp. INML2 Isolate Coreidae
54 8102145433 Caballeronia sp. LP006 Isolate Coreidae
55 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
59 2791354941 Bombella intestini R-52487 Isolate Unclassified
60 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
61 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
62 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
63 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
64 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
65 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
66 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
67 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
68 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
69 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
70 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
71 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
72 8074750600 Commensalibacter sp. W8163 Isolate Apidae
73 8102124461 Caballeronia sp. INML3B Isolate Coreidae
74 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
75 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
76 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
77 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
78 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
79 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
80 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
81 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
82 2785510743 Apibacter sp. ESL0404 Isolate Apidae
83 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
84 2835008077 Commensalibacter intestini DmL_052 Isolate Drosophilidae
85 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
86 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
87 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
88 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
89 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
90 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
91 8074810961 Bombella apis SME1 Isolate Apidae
92 8074871419 Commensalibacter sp. M0133 Isolate Apidae
93 8074884171 Commensalibacter sp. M0355 Isolate Apidae
94 8100534375 Gluconobacter sp. Dm-74 Isolate Drosophilidae
95 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
96 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
97 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
98 8102117041 Caballeronia sp. INML3 Isolate Coreidae
99 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
100 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
101 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
102 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
103 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
104 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
105 2832343623 Apibacter adventoris wkB180 Isolate Apidae
106 2834165886 Saccharibacter sp. M18 Isolate Apidae
107 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
108 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
109 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
110 2901819457 Bombella sp. ESL0385 Isolate Apidae
111 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
112 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
113 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
114 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
115 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
116 8067579126 Gluconobacter kondonii Dm-16 Isolate Drosophilidae
117 8067581993 Gluconobacter kondonii Dm-54 Isolate Drosophilidae
118 8074882376 Commensalibacter sp. M0270 Isolate Apidae
119 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
120 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
121 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
122 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
123 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
124 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
125 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
126 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
127 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
128 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
129 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
130 2967491045 Entomobacter blattae G55GP Isolate Unclassified
131 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
132 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
133 2513237339 Commensalibacter intestini A911 Isolate Drosophilidae
134 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
135 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
136 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
137 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
138 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
139 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
140 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
141 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
142 2920412021 Bombella sp. ESL0387 Isolate Apidae
143 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
144 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
145 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
146 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
147 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
148 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
149 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
150 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
151 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
152 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
153 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
154 8067588748 Gluconobacter kondonii Dm-42 Isolate Drosophilidae
155 8074809037 Bombella apis MRM1 Isolate Apidae
156 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
157 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
158 8102102351 Caballeronia sp. INML1 Isolate Coreidae
159 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
160 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
161 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
162 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
163 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
164 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
165 3002401049 Gluconobacter sp. Dm-62 Isolate Drosophilidae
166 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
167 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
168 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
169 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
170 2751185679 Parasaccharibacter apium G7_7_3c Isolate Apidae
171 2831736028 Parasaccharibacter apium A29 Isolate Apidae
172 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
173 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
174 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
175 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
176 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
177 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
178 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
179 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
180 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
181 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
182 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
183 8067585538 Gluconobacter kondonii Dm-68 Isolate Drosophilidae
184 8074743123 Commensalibacter melissae M0402 Isolate Apidae
185 8074812948 Bombella apis MRM1 Isolate Apidae
186 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
187 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
188 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
189 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
190 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
191 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
192 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
193 2512047014 Acetobacter tropicalis B1.3 Isolate Tephritidae
194 2832372155 Apibacter adventoris wkB301 Isolate Apidae
195 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
196 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
197 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
198 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
199 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
200 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
201 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
202 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
203 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
204 8023757577 Caballeronia peredens LP006 Isolate Coreidae
205 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
206 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
207 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
208 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
209 8067591850 Gluconobacter kondonii Dm-47 Isolate Drosophilidae
210 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
211 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
212 8074737057 Commensalibacter sp. M0357 Isolate Apidae
213 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
214 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
215 8074873247 Commensalibacter sp. M0134 Isolate Apidae
216 8074876897 Commensalibacter sp. M0266 Isolate Apidae
217 8100528075 Gluconobacter sp. Dm-44 Isolate Drosophilidae
218 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
219 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
220 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
221 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
222 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0074302_1003573 3300005316 Unclassified 1363
2 Ga0466690_212757 3300042590 Bacteria 11398
3 Ga0160442_100009 3300012806 Bacteria 498468
4 Ga0466715_227792 3300042616 Bacteria 3048
5 Ga0466715_459271 3300042616 Bacteria 28994
6 Ga0466723_020117 3300042618 Bacteria 21671
7 Ga0466730_065448 3300042625 Bacteria 13247
8 Ga0466704_008179 3300042643 Bacteria 8738
9 Ga0466709_018256 3300042648 Bacteria 49315
10 Ga0466727_028469 3300042655 Bacteria 1171
11 Ga0466706_274977 3300042599 Bacteria 1190
12 Ga0466722_052005 3300042609 Bacteria 18786
13 Ga0160452_100061 3300012834 Bacteria 144414
14 Ga0466690_186066 3300042590 Bacteria 4983
15 Ga0466690_213523 3300042590 Bacteria 18139
16 Ga0466691_065787 3300042593 Bacteria 5120
17 Ga0466711_356861 3300042615 Bacteria 4558
18 Ga0466715_102786 3300042616 Bacteria 21811
19 Ga0466723_151700 3300042618 Bacteria 12963
20 Ga0466728_230496 3300042620 Bacteria 10813
21 Ga0466729_161010 3300042621 Bacteria 14959
22 Ga0466703_110430 3300042636 Bacteria 10993
23 Ga0466719_010406 3300042606 Bacteria 2309
24 Ga0466722_239940 3300042609 Bacteria 60486
25 Ga0466690_035434 3300042590 Bacteria 19417
26 Ga0466690_061009 3300042590 Bacteria 3960
27 Ga0466691_148971 3300042593 Bacteria 4642
28 Ga0466705_401123 3300042612 Bacteria 3950
29 Ga0466703_028325 3300042636 Bacteria 3118
30 Ga0466703_175800 3300042636 Bacteria 6967
31 Ga0466703_261081 3300042636 Bacteria 5647
32 Ga0466704_017077 3300042643 Bacteria 12951
33 Ga0466706_205072 3300042599 Bacteria 5235
34 Ga0466707_074933 3300042601 Bacteria 9174
35 Ga0466713_126571 3300042602 Bacteria 4827
36 Ga0466719_336230 3300042606 Bacteria 6828
37 Ga0466733_023942 3300042659 Bacteria 35698
38 Ga0562377_0004 3300056842 Bacteria 3525959
39 IMNBL1DRAFT_c0002216 3300000062 Bacteria 13711
40 Ga0068302_10218441 3300005071 Unclassified 2825
41 Ga0105524_105789 3300007733 Bacteria 2029
42 Ga0466696_235233 3300042596 Bacteria 8310
43 Ga0466723_004606 3300042618 Bacteria 2751
44 Ga0466726_063492 3300042619 Bacteria 11296
45 Ga0466728_030831 3300042620 Unclassified 2002
46 Ga0466728_057195 3300042620 Bacteria 5908
47 Ga0466735_001812 3300042624 Bacteria 4379
48 Ga0466704_550461 3300042643 Bacteria 4615
49 Ga0466709_130141 3300042648 Bacteria 11945
50 Ga0466727_061730 3300042655 Bacteria 3749
51 Ga0466713_045587 3300042602 Bacteria 50252
52 Ga0466713_079789 3300042602 Bacteria 1278
53 Ga0466733_188344 3300042659 Bacteria 9265
54 Ga0074278_138249 3300005721 Bacteria 57710
55 Ga0160467_100783 3300012829 Bacteria 21712
56 Ga0466692_069631 3300042591 Bacteria 1304
57 Ga0123355_10213423 3300009826 Bacteria 2792
58 Ga0466735_078306 3300042624 Bacteria 1735
59 Ga0466708_119807 3300042652 Bacteria 1465
60 Ga0466706_255935 3300042599 Bacteria 48242
61 Ga0466707_113013 3300042601 Bacteria 10240
62 HBC_ctgsDRAFT_1000021 3300000333 Bacteria 41129
63 Ga0466711_343868 3300042615 Bacteria 17050
64 Ga0466715_494309 3300042616 Bacteria 6447
65 Ga0466703_415807 3300042636 Bacteria 1691
66 Ga0466704_244636 3300042643 Bacteria 19020
67 Ga0466704_410800 3300042643 Bacteria 5667
68 Ga0466709_219765 3300042648 Bacteria 5631
69 Ga0466727_050572 3300042655 Bacteria 5938
70 Ga0466707_030501 3300042601 Bacteria 17725
71 Ga0466707_409854 3300042601 Bacteria 5947
72 Ga0466719_235377 3300042606 Bacteria 1837
73 Ga0466705_103612 3300042612 Bacteria 55765
74 Ga0160448_100481 3300012854 Bacteria 13770
75 Ga0466690_373162 3300042590 Bacteria 16201
76 Ga0466696_024642 3300042596 Bacteria 3435
77 Ga0466715_379183 3300042616 Bacteria 14168
78 Ga0466726_109943 3300042619 Unclassified 3935
79 Ga0466728_108193 3300042620 Bacteria 15541
80 Ga0466703_238767 3300042636 Bacteria 31663
81 Ga0466704_368293 3300042643 Bacteria 2708
82 Ga0466706_170625 3300042599 Bacteria 21733
83 Ga0466707_145573 3300042601 Unclassified 2872
84 Ga0466719_298340 3300042606 Bacteria 1447
85 Ga0466719_393562 3300042606 Bacteria 1844
86 Ga0074308_1113971 3300005307 Bacteria 2279
87 Ga0466711_147968 3300042615 Bacteria 9655
88 Ga0466715_514362 3300042616 Bacteria 34842
89 Ga0466723_003516 3300042618 Bacteria 3112
90 Ga0466723_167633 3300042618 Bacteria 11118
91 Ga0466704_382019 3300042643 Bacteria 21752
92 Ga0466708_196872 3300042652 Bacteria 5587
93 Ga0466713_020044 3300042602 Bacteria 3882
94 Ga0466722_152891 3300042609 Bacteria 26871
95 Ga0466722_187737 3300042609 Bacteria 3143

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2899194184 2899194821 225
2 3300042652 Ga0466708_196872 Ga0466708_196872_3482_4183 233
3 3300042612 Ga0466705_103612 Ga0466705_103612_27717_28427 236
4 3300042636 Ga0466703_175800 Ga0466703_175800_4642_5352 236
5 3300042643 Ga0466704_008179 Ga0466704_008179_5617_6327 236
6 3300042643 Ga0466704_382019 Ga0466704_382019_17595_18305 236
7 3300042599 Ga0466706_170625 Ga0466706_170625_6453_7166 237
8 3300042599 Ga0466706_205072 Ga0466706_205072_1983_2696 237
9 3300042599 Ga0466706_255935 Ga0466706_255935_32838_33551 237
10 iso_pr_bacteria 2513237339 2514544083 237
11 3300042643 Ga0466704_017077 Ga0466704_017077_7055_7771 238
12 3300042590 Ga0466690_373162 Ga0466690_373162_5191_5910 239
13 3300042616 Ga0466715_514362 Ga0466715_514362_3032_3751 239
14 3300042620 Ga0466728_230496 Ga0466728_230496_7742_8461 239
15 3300042655 Ga0466727_050572 Ga0466727_050572_1969_2700 243
16 3300012854 Ga0160448_100481 Ga0160448_10048110 245
17 3300042590 Ga0466690_061009 Ga0466690_061009_3146_3883 245
18 3300042590 Ga0466690_186066 Ga0466690_186066_4169_4906 245
19 3300042590 Ga0466690_213523 Ga0466690_213523_15013_15750 245
20 3300042593 Ga0466691_065787 Ga0466691_065787_2694_3431 245
21 3300042596 Ga0466696_024642 Ga0466696_024642_2684_3421 245
22 3300042596 Ga0466696_235233 Ga0466696_235233_5225_5962 245
23 3300042606 Ga0466719_010406 Ga0466719_010406_289_1026 245
24 3300042606 Ga0466719_235377 Ga0466719_235377_1068_1805 245
25 3300042606 Ga0466719_298340 Ga0466719_298340_91_828 245
26 3300042606 Ga0466719_336230 Ga0466719_336230_4106_4843 245
27 3300042606 Ga0466719_393562 Ga0466719_393562_508_1245 245
28 3300042609 Ga0466722_052005 Ga0466722_052005_17047_17784 245
29 3300042612 Ga0466705_401123 Ga0466705_401123_1314_2051 245
30 3300042615 Ga0466711_356861 Ga0466711_356861_1793_2530 245
31 3300042616 Ga0466715_102786 Ga0466715_102786_3532_4269 245
32 3300042616 Ga0466715_379183 Ga0466715_379183_11258_11995 245
33 3300042618 Ga0466723_003516 Ga0466723_003516_201_938 245
34 3300042618 Ga0466723_004606 Ga0466723_004606_1979_2716 245
35 3300042618 Ga0466723_167633 Ga0466723_167633_9959_10696 245
36 3300042619 Ga0466726_063492 Ga0466726_063492_5682_6419 245
37 3300042619 Ga0466726_109943 Ga0466726_109943_1786_2523 245
38 3300042620 Ga0466728_030831 Ga0466728_030831_976_1713 245
39 3300042636 Ga0466703_110430 Ga0466703_110430_5681_6418 245
40 3300042636 Ga0466703_261081 Ga0466703_261081_2709_3446 245
41 3300042643 Ga0466704_244636 Ga0466704_244636_14685_15422 245
42 3300042643 Ga0466704_410800 Ga0466704_410800_3541_4278 245
43 3300042648 Ga0466709_219765 Ga0466709_219765_1256_1993 245
44 3300005071 Ga0068302_10218441 Ga0068302_102184413 246
45 3300042591 Ga0466692_069631 Ga0466692_069631_543_1283 246
46 3300042593 Ga0466691_148971 Ga0466691_148971_1639_2379 246
47 3300042599 Ga0466706_274977 Ga0466706_274977_240_980 246
48 3300042601 Ga0466707_074933 Ga0466707_074933_7428_8168 246
49 3300042601 Ga0466707_113013 Ga0466707_113013_4376_5116 246
50 3300042601 Ga0466707_145573 Ga0466707_145573_1786_2526 246
51 3300042602 Ga0466713_045587 Ga0466713_045587_12709_13449 246
52 3300042602 Ga0466713_079789 Ga0466713_079789_404_1144 246
53 3300042602 Ga0466713_126571 Ga0466713_126571_2014_2754 246
54 3300042615 Ga0466711_147968 Ga0466711_147968_1418_2158 246
55 3300042615 Ga0466711_343868 Ga0466711_343868_8189_8929 246
56 3300042616 Ga0466715_227792 Ga0466715_227792_101_841 246
57 3300042616 Ga0466715_459271 Ga0466715_459271_21422_22162 246
58 3300042621 Ga0466729_161010 Ga0466729_161010_6796_7536 246
59 3300042624 Ga0466735_001812 Ga0466735_001812_368_1108 246
60 3300042624 Ga0466735_078306 Ga0466735_078306_327_1067 246
61 3300042643 Ga0466704_550461 Ga0466704_550461_1331_2071 246
62 3300042648 Ga0466709_018256 Ga0466709_018256_11897_12637 246
63 3300042652 Ga0466708_119807 Ga0466708_119807_54_794 246
64 3300042659 Ga0466733_023942 Ga0466733_023942_24838_25578 246
65 3300042659 Ga0466733_188344 Ga0466733_188344_2409_3149 246
66 3300056842 Ga0562377_0004 Ga0562377_0004_2706261_2707001 246
67 iso_pr_bacteria 2695420317 2695483689 246
68 iso_pr_bacteria 2695420931 2698108757 246
69 iso_pr_bacteria 2830041218 2830041708 246
70 iso_pr_bacteria 2864878056 2864880448 246
71 iso_pr_bacteria 2864886855 2864889248 246
72 iso_pr_bacteria 2873600114 2873601344 246
73 iso_pr_bacteria 2873610414 2873611703 246
74 iso_pr_bacteria 2891591111 2891592355 246
75 iso_pr_bacteria 2910930387 2910932945 246
76 iso_pr_bacteria 2940193328 2940194883 246
77 iso_pr_bacteria 2940202316 2940202706 246
78 iso_pr_bacteria 2940336608 2940338117 246
79 iso_pr_bacteria 8100157865 8100159546 246
80 3300007733 Ga0105524_105789 Ga0105524_1057892 247
81 3300042602 Ga0466713_020044 Ga0466713_020044_516_1259 247
82 3300042625 Ga0466730_065448 Ga0466730_065448_7770_8513 247
83 3300042655 Ga0466727_028469 Ga0466727_028469_29_772 247
84 iso_pr_bacteria 2512047014 2512309785 247
85 iso_pr_bacteria 2513237393 2514726596 247
86 iso_pr_bacteria 2597489944 2598058076 247
87 iso_pr_bacteria 2597490292 2598960116 247
88 iso_pr_bacteria 2617271320 2619533353 247
89 iso_pr_bacteria 2724678956 2724790494 247
90 iso_pr_bacteria 2751185679 2752856494 247
91 iso_pr_bacteria 2756170209 2756540959 247
92 iso_pr_bacteria 2775507278 2778219349 247
93 iso_pr_bacteria 2786546124 2786627747 247
94 iso_pr_bacteria 2791354941 2792067109 247
95 iso_pr_bacteria 2816332478 2818029514 247
96 iso_pr_bacteria 2831736028 2831736845 247
97 iso_pr_bacteria 2833052049 2833053354 247
98 iso_pr_bacteria 2834143536 2834144878 247
99 iso_pr_bacteria 2834160066 2834160332 247
100 iso_pr_bacteria 2834165886 2834166908 247
101 iso_pr_bacteria 2834852038 2834852374 247
102 iso_pr_bacteria 2835008077 2835009960 247
103 iso_pr_bacteria 2841175817 2841178192 247
104 iso_pr_bacteria 2843864159 2843867003 247
105 iso_pr_bacteria 2854518031 2854519530 247
106 iso_pr_bacteria 2854520951 2854521790 247
107 iso_pr_bacteria 2854536247 2854539568 247
108 iso_pr_bacteria 2854548700 2854550525 247
109 iso_pr_bacteria 2854576727 2854579238 247
110 iso_pr_bacteria 2858084324 2858084435 247
111 iso_pr_bacteria 2858089842 2858092825 247
112 iso_pr_bacteria 2858102877 2858104037 247
113 iso_pr_bacteria 2858105562 2858106303 247
114 iso_pr_bacteria 2858110640 2858112878 247
115 iso_pr_bacteria 2858119979 2858121750 247
116 iso_pr_bacteria 2858129007 2858130634 247
117 iso_pr_bacteria 2868677537 2868680084 247
118 iso_pr_bacteria 2868683769 2868685850 247
119 iso_pr_bacteria 2884203697 2884204955 247
120 iso_pr_bacteria 2891605396 2891606662 247
121 iso_pr_bacteria 2891610497 2891611782 247
122 iso_pr_bacteria 2891614855 2891616136 247
123 iso_pr_bacteria 2891675627 2891676987 247
124 iso_pr_bacteria 2891690481 2891691786 247
125 iso_pr_bacteria 2901819457 2901820640 247
126 iso_pr_bacteria 2920412021 2920413492 247
127 iso_pr_bacteria 2920413932 2920415124 247
128 iso_pr_bacteria 2967491045 2967493527 247
129 iso_pr_bacteria 3002401049 3002403382 247
130 iso_pr_bacteria 8023724303 8023730066 247
131 iso_pr_bacteria 8023747282 8023750336 247
132 iso_pr_bacteria 8023752828 8023754580 247
133 iso_pr_bacteria 8023757577 8023763340 247
134 iso_pr_bacteria 8023764196 8023770572 247
135 iso_pr_bacteria 8024001094 8024003065 247
136 iso_pr_bacteria 8024014383 8024016237 247
137 iso_pr_bacteria 8024019580 8024020531 247
138 iso_pr_bacteria 8024025509 8024026339 247
139 iso_pr_bacteria 8024044713 8024046663 247
140 iso_pr_bacteria 8025650824 8025652842 247
141 iso_pr_bacteria 8025658853 8025661143 247
142 iso_pr_bacteria 8025666332 8025668209 247
143 iso_pr_bacteria 8025671076 8025673073 247
144 iso_pr_bacteria 8025678175 8025680027 247
145 iso_pr_bacteria 8025685901 8025688401 247
146 iso_pr_bacteria 8025694439 8025696628 247
147 iso_pr_bacteria 8025701579 8025706980 247
148 iso_pr_bacteria 8025708040 8025710086 247
149 iso_pr_bacteria 8025723035 8025724882 247
150 iso_pr_bacteria 8025728939 8025731046 247
151 iso_pr_bacteria 8025735396 8025737034 247
152 iso_pr_bacteria 8025747911 8025750033 247
153 iso_pr_bacteria 8025756023 8025758145 247
154 iso_pr_bacteria 8067579126 8067579384 247
155 iso_pr_bacteria 8067581993 8067583500 247
156 iso_pr_bacteria 8067588748 8067588797 247
157 iso_pr_bacteria 8067591850 8067594852 247
158 iso_pr_bacteria 8067594896 8067596578 247
159 iso_pr_bacteria 8069748016 8069749949 247
160 iso_pr_bacteria 8069755105 8069757227 247
161 iso_pr_bacteria 8069770227 8069773281 247
162 iso_pr_bacteria 8069775773 8069777525 247
163 iso_pr_bacteria 8074737057 8074737522 247
164 iso_pr_bacteria 8074743123 8074743518 247
165 iso_pr_bacteria 8074745029 8074745382 247
166 iso_pr_bacteria 8074746876 8074747216 247
167 iso_pr_bacteria 8074748739 8074749084 247
168 iso_pr_bacteria 8074750600 8074751049 247
169 iso_pr_bacteria 8074809037 8074809396 247
170 iso_pr_bacteria 8074810961 8074812218 247
171 iso_pr_bacteria 8074812948 8074813714 247
172 iso_pr_bacteria 8074832014 8074832808 247
173 iso_pr_bacteria 8074867669 8074868012 247
174 iso_pr_bacteria 8074869529 8074869916 247
175 iso_pr_bacteria 8074871419 8074872084 247
176 iso_pr_bacteria 8074873247 8074874061 247
177 iso_pr_bacteria 8074875073 8074875428 247
178 iso_pr_bacteria 8074876897 8074877250 247
179 iso_pr_bacteria 8074878724 8074879077 247
180 iso_pr_bacteria 8074880551 8074880887 247
181 iso_pr_bacteria 8074882376 8074882753 247
182 iso_pr_bacteria 8074884171 8074884632 247
183 iso_pr_bacteria 8078130113 8078132105 247
184 iso_pr_bacteria 8100528075 8100529881 247
185 iso_pr_bacteria 8100531325 8100532945 247
186 iso_pr_bacteria 8100534375 8100536609 247
187 iso_pr_bacteria 8101960468 8101962471 247
188 iso_pr_bacteria 8101967387 8101969389 247
189 iso_pr_bacteria 8101974301 8101976295 247
190 iso_pr_bacteria 8101981714 8101983716 247
191 iso_pr_bacteria 8101988189 8101990271 247
192 iso_pr_bacteria 8102001125 8102002979 247
193 iso_pr_bacteria 8102007614 8102009568 247
194 iso_pr_bacteria 8102014801 8102016769 247
195 iso_pr_bacteria 8102020860 8102023174 247
196 iso_pr_bacteria 8102026984 8102029079 247
197 iso_pr_bacteria 8102033761 8102036161 247
198 iso_pr_bacteria 8102041249 8102043208 247
199 iso_pr_bacteria 8102047609 8102049704 247
200 iso_pr_bacteria 8102054868 8102056788 247
201 iso_pr_bacteria 8102060671 8102062811 247
202 iso_pr_bacteria 8102067727 8102069736 247
203 iso_pr_bacteria 8102074813 8102076882 247
204 iso_pr_bacteria 8102081745 8102083782 247
205 iso_pr_bacteria 8102087471 8102089455 247
206 iso_pr_bacteria 8102094248 8102096524 247
207 iso_pr_bacteria 8102102351 8102104311 247
208 iso_pr_bacteria 8102109360 8102111375 247
209 iso_pr_bacteria 8102117041 8102118975 247
210 iso_pr_bacteria 8102124461 8102126595 247
211 iso_pr_bacteria 8102138357 8102140364 247
212 iso_pr_bacteria 8102145433 8102151196 247
213 iso_pr_bacteria 8102152052 8102158428 247
214 iso_pr_bacteria 8102161003 8102166935 247
215 iso_pr_bacteria 8102169119 8102170757 247
216 iso_pr_bacteria 8102174626 8102176733 247
217 iso_pr_bacteria 8102181083 8102182930 247
218 iso_pr_bacteria 8102193924 8102195969 247
219 iso_pr_bacteria 8102201977 8102207378 247
220 iso_pr_bacteria 8102208438 8102210456 247
221 iso_pr_bacteria 8102216467 8102218656 247
222 iso_pr_bacteria 8102223607 8102225604 247
223 iso_pr_bacteria 8102230706 8102233206 247
224 iso_pr_bacteria 8102239244 8102241095 247
225 iso_pr_bacteria 8102246966 8102248843 247
226 iso_pr_bacteria 8102251710 8102254000 247
227 iso_pr_bacteria 8102264549 8102266632 247
228 iso_pr_bacteria 8102271933 8102274095 247
229 iso_pr_bacteria 8102312426 8102314432 247
230 3300005307 Ga0074308_1113971 Ga0074308_11139712 248
231 3300005316 Ga0074302_1003573 Ga0074302_10035732 248
232 3300005721 Ga0074278_138249 Ga0074278_13824928 248
233 3300009826 Ga0123355_10213423 Ga0123355_102134232 248
234 3300012806 Ga0160442_100009 Ga0160442_100009431 248
235 3300012829 Ga0160467_100783 Ga0160467_10078321 248
236 3300012834 Ga0160452_100061 Ga0160452_10006143 248
237 3300042620 Ga0466728_057195 Ga0466728_057195_143_889 248
238 3300042620 Ga0466728_108193 Ga0466728_108193_9193_9939 248
239 3300042636 Ga0466703_415807 Ga0466703_415807_760_1506 248
240 iso_pr_bacteria 2785510743 2785735699 248
241 iso_pr_bacteria 2799112231 2799233620 248
242 iso_pr_bacteria 2832298047 2832299204 248
243 iso_pr_bacteria 2832343623 2832344506 248
244 iso_pr_bacteria 2832372155 2832373204 248
245 3300000333 HBC_ctgsDRAFT_1000021 HBC_ctgsDRAFT_100002128 249
246 3300042609 Ga0466722_152891 Ga0466722_152891_13201_13950 249
247 3300042609 Ga0466722_239940 Ga0466722_239940_48190_48939 249
248 iso_pr_bacteria 2910926975 2910928422 249
249 iso_pr_bacteria 8116947750 8116949218 249
250 3300042590 Ga0466690_035434 Ga0466690_035434_17947_18705 252
251 3300042655 Ga0466727_061730 Ga0466727_061730_644_1402 252
252 iso_pr_bacteria 2940205530 2940206308 253
253 iso_pr_bacteria 2940212447 2940213418 253
254 iso_pr_bacteria 2940298504 2940299279 253
255 iso_pr_bacteria 2940302308 2940303279 253
256 iso_pr_bacteria 2940306115 2940306824 253
257 iso_pr_bacteria 2940309933 2940310640 253
258 iso_pr_bacteria 2940313741 2940314645 253
259 iso_pr_bacteria 2940317558 2940318460 253
260 iso_pr_bacteria 2940321370 2940322272 253
261 iso_pr_bacteria 2940325180 2940326151 253
262 iso_pr_bacteria 2940328985 2940329762 253
263 iso_pr_bacteria 2940332795 2940333504 253
264 3300000062 IMNBL1DRAFT_c0002216 IMNBL1DRAFT_00022167 254
265 3300042618 Ga0466723_151700 Ga0466723_151700_9298_10062 254
266 iso_pr_bacteria 2839192570 2839192768 255
267 3300042648 Ga0466709_130141 Ga0466709_130141_9032_9802 256
268 iso_pr_bacteria 2854540230 2854542373 256
269 iso_pr_bacteria 8067585538 8067588538 256
270 3300042590 Ga0466690_212757 Ga0466690_212757_395_1171 258
271 3300042636 Ga0466703_238767 Ga0466703_238767_23193_23969 258
272 iso_pr_bacteria 651324000 651476711 262
273 iso_pr_bacteria 3004672520 3004675792 268
274 3300042609 Ga0466722_187737 Ga0466722_187737_257_1072 271
275 3300042601 Ga0466707_030501 Ga0466707_030501_140_958 272
276 3300042618 Ga0466723_020117 Ga0466723_020117_12537_13388 277
277 3300042601 Ga0466707_409854 Ga0466707_409854_94_939 281
278 3300042636 Ga0466703_028325 Ga0466703_028325_646_1491 281
279 3300042616 Ga0466715_494309 Ga0466715_494309_3518_4369 283
280 3300042643 Ga0466704_368293 Ga0466704_368293_1286_2152 288

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02754 CCG Cysteine-rich domain 170 265 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.