Protein Family IF09487

Metagenome Isolate
208 Members
74 Samples
177 Scaffolds
458.07 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_363108|Ga0466704_363108_22132_23619
Length
495 aa
Sequence
MNDNMTKPVPYFKIKAGIRFVLHSICPIFGNELKLYLMFSKETYMDRRTSLKKAIGSGLLLFSGNDEAGCNYAGNTYPYRQDSTFLYFFGQPYAGLSAVIDIDDDREIIFGDEPTMDDIIWMGTQPTLREKCAFAGISELMPAGAVTDFLQKARQKGRAVHYLPSYRPEHKLTLWKRLGVLPDEEKSSADFIRAVVNLRNYKSDEEVAEIEKACLVTADMHLAAMRAIRPGIHEYEVVAAIESVAGARNCALSFPVIATVNGQTLHNHYHGNPVKSGDLFLVDAGAETAACYAGDMSSTTPADHRFTAWQADIYRIQTAMHDQSVEALRPGIAFEEVYDISARVMIEGLKGLGLMRGDTEEALASGAYALFYPHGLGHMMGLDVHDMENLGEVYVGYDGRPKSKQFGRASLRLGRVLEPGFVHTIEPGVYFIPELIDQWKAENKYPGFINYEKLEACKSFGGIRNEEDYLITETGARLLGKRIPRTVEEVEAFRD

📊 Sample Types

Isolate 14.9%
Metagenome 85.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 30.1%
Termitidae 19.2%
Kalotermitidae 19.2%
Unclassified 13.7%
Rhinotermitidae 6.8%
Termopsidae 5.5%
Passalidae 4.1%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
9 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
10 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
13 2923982719 Parabacteroides sp. 52 Isolate Blattidae
14 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
15 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
16 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
17 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
18 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
31 3004677695 Bacteroides sp. 214 Isolate Blattidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
35 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
36 3004667792 Bacteroides sp. 519 Isolate Blattidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2922326829 Bacteroides sp. 224 Isolate Blattidae
43 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
49 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
50 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
51 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
52 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
53 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
54 3004672520 Bacteroides sp. 51 Isolate Blattidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
57 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
58 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
59 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
62 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
63 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
64 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
65 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
66 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
67 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
68 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
69 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
70 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
71 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
72 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
73 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
74 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_092876 3300042659 Bacteria 23009
2 Ga0466656_224030 3300042550 Bacteria 11159
3 Ga0466691_227930 3300042593 Bacteria 8490
4 Ga0466706_007881 3300042599 Bacteria 5450
5 Ga0466706_083922 3300042599 Bacteria 29703
6 Ga0466706_276180 3300042599 Bacteria 65753
7 Ga0466713_001786 3300042602 Bacteria 6561
8 Ga0466713_052219 3300042602 Bacteria 69085
9 Ga0466703_047725 3300042636 Bacteria 13908
10 Ga0466703_060494 3300042636 Bacteria 13418
11 Ga0466703_087048 3300042636 Bacteria 8460
12 Ga0466703_130712 3300042636 Bacteria 3819
13 Ga0466703_349706 3300042636 Bacteria 2701
14 Ga0466704_203482 3300042643 Bacteria 1742
15 Ga0466709_307822 3300042648 Bacteria 161839
16 Ga0466727_172499 3300042655 Bacteria 33707
17 Ga0466711_176509 3300042615 Bacteria 3941
18 Ga0466711_465049 3300042615 Bacteria 7689
19 Ga0466715_330145 3300042616 Bacteria 25669
20 Ga0466723_163674 3300042618 Bacteria 19967
21 Ga0466726_362804 3300042619 Bacteria 3457
22 Ga0466728_389311 3300042620 Bacteria 12570
23 JGI24702J35022_10024060 3300002462 Bacteria 3291
24 Ga0068302_10235909 3300005071 Unclassified 4983
25 Ga0068305_10002064 3300005083 Bacteria 156822
26 Ga0123356_10177578 3300010049 Bacteria 2148
27 Ga0466733_026963 3300042659 Bacteria 2086
28 Ga0466733_194723 3300042659 Bacteria 4492
29 Ga0466690_014891 3300042590 Bacteria 6996
30 Ga0466690_273455 3300042590 Bacteria 11832
31 Ga0466707_410798 3300042601 Bacteria 5211
32 Ga0466713_073650 3300042602 Bacteria 22168
33 Ga0466716_282690 3300042605 Bacteria 17125
34 Ga0466716_386438 3300042605 Bacteria 23382
35 Ga0466722_261229 3300042609 Bacteria 1978
36 Ga0466704_130597 3300042643 Bacteria 2549
37 Ga0466704_169299 3300042643 Bacteria 16366
38 Ga0466709_292381 3300042648 Bacteria 26299
39 Ga0466727_089930 3300042655 Bacteria 5420
40 Ga0466727_232308 3300042655 Bacteria 4037
41 Ga0466711_118017 3300042615 Bacteria 3040
42 Ga0466723_068280 3300042618 Bacteria 19935
43 Ga0466728_288116 3300042620 Bacteria 7389
44 Ga0068302_10009782 3300005071 Bacteria 6256
45 Ga0466705_204903 3300042612 Bacteria 8303
46 Ga0466656_031987 3300042550 Bacteria 4100
47 Ga0466690_323146 3300042590 Bacteria 40006
48 Ga0466690_325148 3300042590 Bacteria 13281
49 Ga0466691_133192 3300042593 Bacteria 19840
50 Ga0466696_088331 3300042596 Bacteria 38541
51 Ga0466706_009507 3300042599 Bacteria 49149
52 Ga0466706_134275 3300042599 Bacteria 1812
53 Ga0466706_251693 3300042599 Bacteria 42498
54 Ga0466716_178319 3300042605 Bacteria 2970
55 Ga0466716_279234 3300042605 Bacteria 7813
56 Ga0466719_030599 3300042606 Bacteria 14291
57 Ga0466735_025195 3300042624 Bacteria 6639
58 Ga0466735_160098 3300042624 Bacteria 2475
59 Ga0466703_376232 3300042636 Bacteria 2186
60 Ga0466704_093118 3300042643 Bacteria 21105
61 Ga0466712_162420 3300042614 Bacteria 2811
62 Ga0466711_168100 3300042615 Bacteria 15409
63 Ga0466723_095121 3300042618 Bacteria 177949
64 Ga0466726_384401 3300042619 Bacteria 4254
65 2227005373 2225789003 Bacteria 5777
66 2227108588 2225789004 Bacteria 37674
67 Ga0123353_10000929 3300010167 Bacteria 35796
68 Ga0466733_013758 3300042659 Bacteria 12063
69 Ga0466691_168669 3300042593 Bacteria 22573
70 Ga0466695_284703 3300042595 Bacteria 56309
71 Ga0466706_119636 3300042599 Bacteria 24059
72 Ga0466707_146028 3300042601 Bacteria 14106
73 Ga0466713_105915 3300042602 Bacteria 69739
74 Ga0466713_123054 3300042602 Bacteria 24516
75 Ga0466716_321736 3300042605 Bacteria 1555
76 Ga0466722_126170 3300042609 Bacteria 47921
77 Ga0466735_103058 3300042624 Bacteria 2000
78 Ga0466703_329220 3300042636 Bacteria 14638
79 Ga0466708_054511 3300042652 Bacteria 38692
80 Ga0466708_138224 3300042652 Bacteria 4475
81 Ga0466727_289965 3300042655 Bacteria 4680
82 Ga0466710_082511 3300042613 Bacteria 7723
83 Ga0466715_157977 3300042616 Bacteria 113033
84 Ga0466726_217472 3300042619 Bacteria 2125
85 Ga0466726_364228 3300042619 Bacteria 7092
86 Ga0466728_209710 3300042620 Bacteria 27061
87 IMNBL1DRAFT_c0000308 3300000062 Bacteria 41637
88 IMNBL1DRAFT_c0008106 3300000062 Bacteria 5405
89 JGI24695J34938_10026136 3300002450 Unclassified 2778
90 Ga0068305_10057279 3300005083 Bacteria 6661
91 Ga0123353_10017545 3300010167 Bacteria 10529
92 Ga0466705_358209 3300042612 Bacteria 6311
93 Ga0466733_137520 3300042659 Bacteria 11726
94 Ga0466657_237884 3300042582 Bacteria 3012
95 Ga0466690_012795 3300042590 Bacteria 12955
96 Ga0466690_270417 3300042590 Bacteria 12377
97 Ga0466690_343341 3300042590 Bacteria 7345
98 Ga0466691_116256 3300042593 Bacteria 26253
99 Ga0466696_021950 3300042596 Bacteria 5759
100 Ga0466696_168682 3300042596 Bacteria 17271
101 Ga0466713_013071 3300042602 Bacteria 30342
102 Ga0466713_053147 3300042602 Bacteria 18593
103 Ga0466713_140837 3300042602 Bacteria 175760
104 Ga0466716_417489 3300042605 Bacteria 27622
105 Ga0466735_021601 3300042624 Bacteria 1733
106 Ga0466735_223524 3300042624 Bacteria 3254
107 Ga0466704_026770 3300042643 Bacteria 49720
108 Ga0466704_103268 3300042643 Bacteria 23780
109 Ga0466704_118870 3300042643 Bacteria 1862
110 Ga0466708_125510 3300042652 Bacteria 1859
111 Ga0466708_259782 3300042652 Bacteria 24929
112 Ga0466715_165242 3300042616 Bacteria 12601
113 Ga0466723_349603 3300042618 Bacteria 4944
114 Ga0466726_431773 3300042619 Bacteria 2154
115 Ga0068305_10088518 3300005083 Bacteria 8526
116 Ga0068305_10097521 3300005083 Bacteria 3173
117 Ga0072941_1294916 3300005201 Bacteria 3173
118 Ga0466705_092074 3300042612 Bacteria 11963
119 Ga0466705_193616 3300042612 Bacteria 42196
120 Ga0466733_006567 3300042659 Bacteria 10919
121 Ga0466690_135688 3300042590 Bacteria 8117
122 Ga0466691_052399 3300042593 Bacteria 16626
123 Ga0466696_259199 3300042596 Bacteria 9698
124 Ga0466706_052074 3300042599 Bacteria 4954
125 Ga0466706_151978 3300042599 Bacteria 59315
126 Ga0466700_130979 3300042600 Bacteria 3153
127 Ga0466700_391565 3300042600 Bacteria 10641
128 Ga0466735_020563 3300042624 Bacteria 1243
129 Ga0466735_116950 3300042624 Bacteria 7138
130 Ga0466703_277371 3300042636 Bacteria 2061
131 Ga0466703_426220 3300042636 Bacteria 39212
132 Ga0466704_363108 3300042643 Bacteria 39184
133 Ga0466708_386592 3300042652 Bacteria 14720
134 Ga0466715_412841 3300042616 Bacteria 4217
135 Ga0466728_412588 3300042620 Bacteria 41529
136 Ga0466705_247067 3300042612 Bacteria 2051
137 Ga0466692_082217 3300042591 Bacteria 9048
138 Ga0466691_049845 3300042593 Bacteria 17289
139 Ga0466691_144468 3300042593 Bacteria 18446
140 Ga0466706_015175 3300042599 Bacteria 5709
141 Ga0466707_091194 3300042601 Bacteria 2445
142 Ga0466714_071176 3300042603 Bacteria 1628
143 Ga0466719_004035 3300042606 Bacteria 3276
144 Ga0466722_139799 3300042609 Bacteria 2029
145 Ga0466729_216104 3300042621 Bacteria 8377
146 Ga0466735_084109 3300042624 Bacteria 2030
147 Ga0466727_076463 3300042655 Bacteria 19902
148 Ga0466705_400119 3300042612 Bacteria 34089
149 Ga0466711_141928 3300042615 Bacteria 17413
150 Ga0466711_144282 3300042615 Bacteria 9623
151 Ga0466715_484657 3300042616 Bacteria 16388
152 Ga0466723_278235 3300042618 Bacteria 28103
153 2227566295 2225789004 Bacteria 14226
154 JGI24695J34938_10034973 3300002450 Bacteria 2301
155 Ga0068305_10074363 3300005083 Unclassified 10836
156 Ga0123355_10000036 3300009826 Bacteria 135537
157 Ga0466705_080971 3300042612 Bacteria 12545
158 Ga0466692_032068 3300042591 Bacteria 25323
159 Ga0466696_151297 3300042596 Bacteria 6433
160 Ga0466696_225714 3300042596 Bacteria 9490
161 Ga0466696_329102 3300042596 Bacteria 26774
162 Ga0466706_082080 3300042599 Bacteria 38933
163 Ga0466713_049043 3300042602 Bacteria 3827
164 Ga0466719_231820 3300042606 Bacteria 2817
165 Ga0466708_089052 3300042652 Bacteria 19306
166 Ga0466725_056801 3300042654 Bacteria 12353
167 Ga0466711_006210 3300042615 Bacteria 3932
168 Ga0466711_015248 3300042615 Bacteria 5152
169 Ga0466711_071376 3300042615 Bacteria 34883
170 Ga0466711_083950 3300042615 Unclassified 2395
171 Ga0466715_041831 3300042616 Bacteria 3617
172 Ga0466715_137784 3300042616 Bacteria 9423
173 Ga0466715_208106 3300042616 Bacteria 46490
174 Ga0466723_093570 3300042618 Bacteria 5757
175 Ga0466723_175652 3300042618 Bacteria 41824
176 Ga0466723_352875 3300042618 Bacteria 7056
177 Ga0068305_10023936 3300005083 Bacteria 16500

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_020563 Ga0466735_020563_33_1232 399
2 3300042602 Ga0466713_052219 Ga0466713_052219_67441_68685 414
3 3300042652 Ga0466708_125510 Ga0466708_125510_561_1838 425
4 3300042620 Ga0466728_389311 Ga0466728_389311_6004_7359 431
5 3300042596 Ga0466696_225714 Ga0466696_225714_1649_3022 436
6 3300042655 Ga0466727_289965 Ga0466727_289965_411_1775 439
7 3300042615 Ga0466711_118017 Ga0466711_118017_229_1602 441
8 2225789004 2227108588 2227496238 444
9 3300042590 Ga0466690_270417 Ga0466690_270417_3305_4639 444
10 3300042601 Ga0466707_091194 Ga0466707_091194_847_2220 445
11 3300042605 Ga0466716_178319 Ga0466716_178319_228_1613 446
12 3300005083 Ga0068305_10057279 Ga0068305_100572793 450
13 3300042596 Ga0466696_088331 Ga0466696_088331_27628_29019 451
14 3300042652 Ga0466708_054511 Ga0466708_054511_35753_37111 452
15 3300042606 Ga0466719_030599 Ga0466719_030599_5116_6477 453
16 3300042615 Ga0466711_141928 Ga0466711_141928_895_2259 454
17 3300042615 Ga0466711_168100 Ga0466711_168100_4015_5379 454
18 3300042599 Ga0466706_007881 Ga0466706_007881_2059_3426 455
19 3300042599 Ga0466706_134275 Ga0466706_134275_281_1648 455
20 3300042606 Ga0466719_004035 Ga0466719_004035_1703_3070 455
21 3300042618 Ga0466723_093570 Ga0466723_093570_1813_3180 455
22 3300042652 Ga0466708_138224 Ga0466708_138224_1955_3322 455
23 3300042654 Ga0466725_056801 Ga0466725_056801_3503_4870 455
24 3300042599 Ga0466706_251693 Ga0466706_251693_19979_21349 456
25 3300042624 Ga0466735_021601 Ga0466735_021601_240_1610 456
26 3300042624 Ga0466735_103058 Ga0466735_103058_298_1668 456
27 3300042624 Ga0466735_116950 Ga0466735_116950_2596_3966 456
28 3300042624 Ga0466735_160098 Ga0466735_160098_787_2157 456
29 3300042624 Ga0466735_223524 Ga0466735_223524_346_1716 456
30 iso_pr_bacteria 2967483437 2967486338 456
31 2225789003 2227005373 2227361086 457
32 3300042590 Ga0466690_012795 Ga0466690_012795_9662_11035 457
33 3300042590 Ga0466690_135688 Ga0466690_135688_192_1565 457
34 3300042590 Ga0466690_343341 Ga0466690_343341_46_1419 457
35 3300042593 Ga0466691_052399 Ga0466691_052399_13978_15351 457
36 3300042593 Ga0466691_116256 Ga0466691_116256_6053_7426 457
37 3300042593 Ga0466691_168669 Ga0466691_168669_12088_13461 457
38 3300042599 Ga0466706_015175 Ga0466706_015175_2685_4058 457
39 3300042599 Ga0466706_052074 Ga0466706_052074_2092_3465 457
40 3300042599 Ga0466706_119636 Ga0466706_119636_526_1899 457
41 3300042599 Ga0466706_151978 Ga0466706_151978_46077_47450 457
42 3300042599 Ga0466706_276180 Ga0466706_276180_61355_62728 457
43 3300042602 Ga0466713_013071 Ga0466713_013071_17482_18855 457
44 3300042602 Ga0466713_049043 Ga0466713_049043_2291_3664 457
45 3300042602 Ga0466713_053147 Ga0466713_053147_2241_3614 457
46 3300042602 Ga0466713_073650 Ga0466713_073650_20366_21739 457
47 3300042602 Ga0466713_105915 Ga0466713_105915_6035_7408 457
48 3300042602 Ga0466713_140837 Ga0466713_140837_77792_79165 457
49 3300042603 Ga0466714_071176 Ga0466714_071176_158_1531 457
50 3300042605 Ga0466716_279234 Ga0466716_279234_4714_6087 457
51 3300042605 Ga0466716_386438 Ga0466716_386438_556_1929 457
52 3300042605 Ga0466716_417489 Ga0466716_417489_12625_13998 457
53 3300042612 Ga0466705_247067 Ga0466705_247067_480_1853 457
54 3300042612 Ga0466705_400119 Ga0466705_400119_26099_27472 457
55 3300042615 Ga0466711_006210 Ga0466711_006210_1329_2702 457
56 3300042615 Ga0466711_015248 Ga0466711_015248_3374_4747 457
57 3300042615 Ga0466711_083950 Ga0466711_083950_621_1994 457
58 3300042615 Ga0466711_176509 Ga0466711_176509_1212_2585 457
59 3300042616 Ga0466715_137784 Ga0466715_137784_1101_2474 457
60 3300042616 Ga0466715_157977 Ga0466715_157977_11049_12422 457
61 3300042616 Ga0466715_165242 Ga0466715_165242_6176_7549 457
62 3300042616 Ga0466715_208106 Ga0466715_208106_6385_7758 457
63 3300042616 Ga0466715_484657 Ga0466715_484657_4235_5608 457
64 3300042618 Ga0466723_068280 Ga0466723_068280_10639_12012 457
65 3300042618 Ga0466723_163674 Ga0466723_163674_666_2039 457
66 3300042618 Ga0466723_349603 Ga0466723_349603_640_2013 457
67 3300042619 Ga0466726_362804 Ga0466726_362804_170_1543 457
68 3300042619 Ga0466726_384401 Ga0466726_384401_2145_3518 457
69 3300042620 Ga0466728_209710 Ga0466728_209710_22065_23438 457
70 3300042620 Ga0466728_412588 Ga0466728_412588_9267_10640 457
71 3300042621 Ga0466729_216104 Ga0466729_216104_4267_5640 457
72 3300042624 Ga0466735_084109 Ga0466735_084109_136_1509 457
73 3300042636 Ga0466703_087048 Ga0466703_087048_3454_4827 457
74 3300042636 Ga0466703_130712 Ga0466703_130712_1296_2669 457
75 3300042636 Ga0466703_277371 Ga0466703_277371_240_1613 457
76 3300042636 Ga0466703_349706 Ga0466703_349706_571_1944 457
77 3300042636 Ga0466703_426220 Ga0466703_426220_31486_32859 457
78 3300042643 Ga0466704_026770 Ga0466704_026770_6111_7484 457
79 3300042643 Ga0466704_103268 Ga0466704_103268_11106_12479 457
80 3300042643 Ga0466704_130597 Ga0466704_130597_250_1623 457
81 3300042643 Ga0466704_203482 Ga0466704_203482_199_1572 457
82 3300042648 Ga0466709_292381 Ga0466709_292381_20913_22286 457
83 3300042652 Ga0466708_386592 Ga0466708_386592_3306_4679 457
84 3300042659 Ga0466733_013758 Ga0466733_013758_558_1931 457
85 3300042659 Ga0466733_092876 Ga0466733_092876_5163_6536 457
86 iso_pr_bacteria 2609459943 2610743619 457
87 iso_pr_bacteria 2820750388 2820750994 457
88 iso_pr_bacteria 2830041218 2830045093 457
89 iso_pr_bacteria 2923982719 2923983475 457
90 iso_pr_bacteria 2940199050 2940201357 457
91 iso_pr_bacteria 2940205530 2940206494 457
92 iso_pr_bacteria 2940212447 2940213232 457
93 iso_pr_bacteria 2940298504 2940299464 457
94 iso_pr_bacteria 2940302308 2940303093 457
95 iso_pr_bacteria 2940306115 2940306993 457
96 iso_pr_bacteria 2940309933 2940310810 457
97 iso_pr_bacteria 2940313741 2940314475 457
98 iso_pr_bacteria 2940317558 2940318289 457
99 iso_pr_bacteria 2940321370 2940322102 457
100 iso_pr_bacteria 2940325180 2940325965 457
101 iso_pr_bacteria 2940328985 2940329948 457
102 iso_pr_bacteria 2940332795 2940333673 457
103 iso_pr_bacteria 2940346213 2940349227 457
104 iso_pr_bacteria 2940371297 2940371405 457
105 iso_pr_bacteria 3004667792 3004670506 457
106 iso_pr_bacteria 3004672520 3004677507 457
107 iso_pr_bacteria 3004677695 3004677789 457
108 iso_pr_bacteria 8100166142 8100170178 457
109 2225789004 2227566295 2228107951 458
110 3300000062 IMNBL1DRAFT_c0008106 IMNBL1DRAFT_00081062 458
111 3300005071 Ga0068302_10009782 Ga0068302_100097824 458
112 3300005083 Ga0068305_10002064 Ga0068305_1000206455 458
113 3300005083 Ga0068305_10023936 Ga0068305_100239362 458
114 3300005083 Ga0068305_10074363 Ga0068305_100743637 458
115 3300005083 Ga0068305_10088518 Ga0068305_100885184 458
116 3300005083 Ga0068305_10097521 Ga0068305_100975213 458
117 3300005201 Ga0072941_1294916 Ga0072941_12949162 458
118 3300042590 Ga0466690_273455 Ga0466690_273455_9411_10787 458
119 3300042590 Ga0466690_323146 Ga0466690_323146_38585_39961 458
120 3300042590 Ga0466690_325148 Ga0466690_325148_1647_3023 458
121 3300042593 Ga0466691_049845 Ga0466691_049845_313_1689 458
122 3300042593 Ga0466691_133192 Ga0466691_133192_13426_14802 458
123 3300042596 Ga0466696_259199 Ga0466696_259199_7996_9372 458
124 3300042596 Ga0466696_329102 Ga0466696_329102_12689_14065 458
125 3300042599 Ga0466706_009507 Ga0466706_009507_42847_44223 458
126 3300042599 Ga0466706_082080 Ga0466706_082080_21664_23040 458
127 3300042601 Ga0466707_146028 Ga0466707_146028_6642_8018 458
128 3300042601 Ga0466707_410798 Ga0466707_410798_3371_4747 458
129 3300042605 Ga0466716_282690 Ga0466716_282690_3964_5340 458
130 3300042606 Ga0466719_231820 Ga0466719_231820_1381_2757 458
131 3300042612 Ga0466705_080971 Ga0466705_080971_2279_3655 458
132 3300042612 Ga0466705_092074 Ga0466705_092074_9755_11131 458
133 3300042612 Ga0466705_193616 Ga0466705_193616_20024_21400 458
134 3300042612 Ga0466705_358209 Ga0466705_358209_4089_5465 458
135 3300042618 Ga0466723_095121 Ga0466723_095121_47489_48865 458
136 3300042619 Ga0466726_217472 Ga0466726_217472_679_2055 458
137 3300042636 Ga0466703_047725 Ga0466703_047725_12153_13529 458
138 3300042636 Ga0466703_060494 Ga0466703_060494_8159_9535 458
139 3300042655 Ga0466727_089930 Ga0466727_089930_4027_5403 458
140 3300042655 Ga0466727_232308 Ga0466727_232308_160_1536 458
141 3300042659 Ga0466733_006567 Ga0466733_006567_2344_3720 458
142 3300042659 Ga0466733_194723 Ga0466733_194723_2932_4308 458
143 iso_pr_bacteria 2922326829 2922328778 458
144 iso_pr_bacteria 2940195863 2940196765 458
145 3300000062 IMNBL1DRAFT_c0000308 IMNBL1DRAFT_000030821 459
146 3300042596 Ga0466696_151297 Ga0466696_151297_3681_5060 459
147 3300042609 Ga0466722_261229 Ga0466722_261229_392_1771 459
148 3300042614 Ga0466712_162420 Ga0466712_162420_1186_2565 459
149 3300042615 Ga0466711_144282 Ga0466711_144282_1056_2435 459
150 3300042615 Ga0466711_465049 Ga0466711_465049_5181_6560 459
151 3300042618 Ga0466723_278235 Ga0466723_278235_3589_4968 459
152 3300042648 Ga0466709_307822 Ga0466709_307822_121712_123091 459
153 3300042652 Ga0466708_089052 Ga0466708_089052_8098_9477 459
154 3300042655 Ga0466727_076463 Ga0466727_076463_18461_19840 459
155 3300005071 Ga0068302_10235909 Ga0068302_102359093 460
156 3300010049 Ga0123356_10177578 Ga0123356_101775782 460
157 3300042593 Ga0466691_227930 Ga0466691_227930_2027_3409 460
158 3300042596 Ga0466696_021950 Ga0466696_021950_3749_5131 460
159 3300042612 Ga0466705_204903 Ga0466705_204903_3864_5246 460
160 3300042616 Ga0466715_330145 Ga0466715_330145_11082_12464 460
161 3300042619 Ga0466726_364228 Ga0466726_364228_216_1598 460
162 3300042619 Ga0466726_431773 Ga0466726_431773_760_2142 460
163 3300042636 Ga0466703_376232 Ga0466703_376232_639_2021 460
164 iso_pr_bacteria 2940202316 2940202616 460
165 3300002462 JGI24702J35022_10024060 JGI24702J35022_100240603 461
166 3300042591 Ga0466692_032068 Ga0466692_032068_8164_9549 461
167 3300042605 Ga0466716_321736 Ga0466716_321736_13_1398 461
168 3300042609 Ga0466722_139799 Ga0466722_139799_412_1797 461
169 3300042618 Ga0466723_175652 Ga0466723_175652_14265_15650 461
170 3300042620 Ga0466728_288116 Ga0466728_288116_270_1655 461
171 3300042636 Ga0466703_329220 Ga0466703_329220_8031_9416 461
172 3300042643 Ga0466704_118870 Ga0466704_118870_259_1644 461
173 3300042652 Ga0466708_259782 Ga0466708_259782_8351_9736 461
174 3300042659 Ga0466733_026963 Ga0466733_026963_538_1923 461
175 3300042582 Ga0466657_237884 Ga0466657_237884_659_2047 462
176 3300042600 Ga0466700_130979 Ga0466700_130979_863_2251 462
177 3300042600 Ga0466700_391565 Ga0466700_391565_86_1474 462
178 3300042609 Ga0466722_126170 Ga0466722_126170_37811_39199 462
179 3300042613 Ga0466710_082511 Ga0466710_082511_5954_7342 462
180 3300042615 Ga0466711_071376 Ga0466711_071376_7698_9086 462
181 3300042616 Ga0466715_041831 Ga0466715_041831_1419_2807 462
182 3300042655 Ga0466727_172499 Ga0466727_172499_32110_33498 462
183 3300042659 Ga0466733_137520 Ga0466733_137520_1720_3108 462
184 iso_pr_bacteria 2820770630 2820771962 462
185 iso_pr_bacteria 2820788205 2820788282 462
186 3300002450 JGI24695J34938_10026136 JGI24695J34938_100261361 463
187 3300009826 Ga0123355_10000036 Ga0123355_1000003680 463
188 3300010167 Ga0123353_10017545 Ga0123353_100175455 463
189 3300042550 Ga0466656_031987 Ga0466656_031987_2407_3798 463
190 3300042590 Ga0466690_014891 Ga0466690_014891_5589_6980 463
191 3300042618 Ga0466723_352875 Ga0466723_352875_1450_2841 463
192 iso_pr_bacteria 2820741847 2820743974 463
193 3300002450 JGI24695J34938_10034973 JGI24695J34938_100349732 464
194 3300042550 Ga0466656_224030 Ga0466656_224030_7021_8415 464
195 3300042591 Ga0466692_082217 Ga0466692_082217_7066_8460 464
196 3300042599 Ga0466706_083922 Ga0466706_083922_5243_6649 468
197 iso_pr_bacteria 2820746860 2820747562 470
198 3300042602 Ga0466713_001786 Ga0466713_001786_5044_6465 473
199 3300042616 Ga0466715_412841 Ga0466715_412841_296_1723 475
200 3300042624 Ga0466735_025195 Ga0466735_025195_2798_4228 476
201 3300042596 Ga0466696_168682 Ga0466696_168682_11094_12527 477
202 3300042595 Ga0466695_284703 Ga0466695_284703_48848_50284 478
203 3300010167 Ga0123353_10000929 Ga0123353_1000092910 481
204 3300042593 Ga0466691_144468 Ga0466691_144468_6446_7894 482
205 3300042602 Ga0466713_123054 Ga0466713_123054_11410_12858 482
206 3300042643 Ga0466704_169299 Ga0466704_169299_8821_10272 483
207 3300042643 Ga0466704_093118 Ga0466704_093118_13193_14665 490
208 3300042643 Ga0466704_363108 Ga0466704_363108_22132_23619 495

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05195 AMP_N Aminopeptidase P, N-terminal domain 44 156 0.95
PF00557 Peptidase_M24 Metallopeptidase family M24 209 473 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.