Protein Family IF09480

Metagenome Isolate
156 Members
71 Samples
139 Scaffolds
363.4 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_352796|Ga0466704_352796_565_1791
Length
408 aa
Sequence
MNIYPKLILDALTKVRYPGTGKNLVEAGMVEDDIRIEGRKVSFTLRFERPGDPFVKSVVKAAETAILTYISPEIDIKGHIAARSLHDARPEPAKLLPEVANIIAVASGKGGVGKSTVSANLAVALAAAGYKTGLLDADIFGPSQPKMFNMEDARPYLAKTGSRDLIQPAENYGVKLLSIGFFVNRDDAVLWRGAMASSALKQLIGDANWGALDYLLIDLPPGTGDIHLTLVQTLAITGAVIVCTPQEVALADARKGINMFTGEKVNVPVLGLIENMAWFTPAELPESRYYIFGKDGGRRLAEELNIPLLGQIPLVQSICESGDAGAPAALNPATTTGAAFHDLAASVVKHAEYRRTHLAPTKRVEPHKSPENSLSRACRNLWTAHHCHRRDAMHRVSTLHPAQSIVNQ

📊 Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 21.5%
Termitidae 18.5%
Unclassified 12.3%
Armadillidiidae 12.3%
Termopsidae 6.2%
Rhinotermitidae 6.2%
Drosophilidae 4.6%
Blattidae 4.6%
Hydrophilidae 3.1%
Formicidae 3.1%
Passalidae 3.1%
Hodotermitidae 1.5%
Bombycidae 1.5%
Daphniidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
2 2898741527 Sphingobacterium sp. xlx-73 Isolate
3 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
13 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
24 2896330536 Sphingobacterium sp. xlx-96 Isolate
25 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
26 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
27 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
28 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
31 2896321640 Sphingobacterium sp. xlx-130 Isolate
32 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
35 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
36 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
41 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
42 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
43 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
44 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2896350215 Sphingobacterium sp. xlx-183 Isolate
48 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
49 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
50 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
51 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
55 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
56 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
57 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
65 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
66 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
67 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_354371 3300042615 Bacteria 7893
2 Ga0160456_100034 3300012820 Bacteria 215854
3 Ga0160443_100103 3300012848 Bacteria 135933
4 Ga0466692_103340 3300042591 Bacteria 5892
5 Ga0466692_165217 3300042591 Bacteria 3405
6 CVPL010W_10003257 3300002931 Bacteria 18743
7 Ga0104050_1000996 3300007153 Bacteria 7884
8 Ga0466715_521826 3300042616 Bacteria 60910
9 Ga0466726_411516 3300042619 Bacteria 1622
10 Ga0466728_215085 3300042620 Bacteria 3023
11 Ga0160454_100001 3300012798 Bacteria 780029
12 Ga0466691_062738 3300042593 Bacteria 3090
13 Ga0466696_050799 3300042596 Bacteria 6802
14 Ga0466734_127602 3300042623 Bacteria 5809
15 Ga0466735_029769 3300042624 Bacteria 1285
16 Ga0466735_197399 3300042624 Bacteria 2853
17 Ga0466704_030869 3300042643 Bacteria 10856
18 Ga0466704_059884 3300042643 Bacteria 4890
19 Ga0466724_32925 3300042649 Bacteria 56965
20 Ga0466701_029789 3300042598 Bacteria 6449
21 Ga0466707_163288 3300042601 Bacteria 4077
22 Ga0466707_345716 3300042601 Unclassified 1853
23 Ga0466713_084333 3300042602 Bacteria 18300
24 Ga0466713_091714 3300042602 Bacteria 189911
25 Ga0466716_152838 3300042605 Bacteria 5263
26 2227550760 2225789004 Bacteria 2853
27 Ga0068302_10125204 3300005071 Bacteria 3674
28 Ga0104045_1001911 3300007085 Bacteria 29584
29 Ga0466715_150026 3300042616 Bacteria 9435
30 Ga0160465_100006 3300012803 Bacteria 411486
31 Ga0160455_100062 3300012837 Bacteria 204480
32 Ga0160457_1000384 3300012858 Unclassified 23700
33 Ga0466696_173954 3300042596 Bacteria 14904
34 Ga0466735_095197 3300042624 Bacteria 1754
35 Ga0466735_147767 3300042624 Bacteria 1564
36 Ga0466704_051515 3300042643 Bacteria 3374
37 Ga0466704_260868 3300042643 Bacteria 18144
38 Ga0466724_07335 3300042649 Bacteria 37493
39 Ga0466724_28482 3300042649 Unclassified 5803
40 Ga0466708_145251 3300042652 Bacteria 10039
41 Ga0466700_387454 3300042600 Bacteria 47059
42 Ga0466707_078274 3300042601 Bacteria 2769
43 Ga0466713_077407 3300042602 Bacteria 3574
44 Ga0466713_091524 3300042602 Bacteria 31228
45 Ga0466716_100304 3300042605 Bacteria 28707
46 Ga0104045_1005451 3300007085 Bacteria 10564
47 Ga0466715_111704 3300042616 Bacteria 7380
48 Ga0466715_624205 3300042616 Bacteria 21451
49 Ga0466728_241856 3300042620 Bacteria 16233
50 Ga0160469_104121 3300012824 Unclassified 1774
51 Ga0160467_100575 3300012829 Bacteria 32125
52 Ga0466692_096609 3300042591 Bacteria 4032
53 Ga0466696_151110 3300042596 Bacteria 63406
54 Ga0466696_400723 3300042596 Bacteria 2195
55 Ga0466701_014287 3300042598 Bacteria 17987
56 Ga0466735_013173 3300042624 Bacteria 6727
57 Ga0466703_159768 3300042636 Bacteria 3135
58 Ga0466707_235811 3300042601 Bacteria 10350
59 Ga0466707_309055 3300042601 Bacteria 10994
60 Ga0068305_10048086 3300005083 Bacteria 11360
61 Ga0102740_1000411 3300007140 Bacteria 11880
62 Ga0466723_147651 3300042618 Bacteria 6618
63 Ga0123357_10055779 3300009784 Bacteria 5317
64 Ga0160467_100018 3300012829 Bacteria 326466
65 Ga0160433_100012 3300012846 Bacteria 265415
66 Ga0466690_013407 3300042590 Bacteria 18918
67 Ga0466730_054806 3300042625 Bacteria 801523
68 Ga0466704_019328 3300042643 Bacteria 11527
69 Ga0466709_203051 3300042648 Bacteria 4756
70 Ga0466706_101829 3300042599 Bacteria 48819
71 Ga0466706_219061 3300042599 Bacteria 18431
72 Ga0466707_257671 3300042601 Bacteria 4852
73 Ga0466719_026084 3300042606 Bacteria 7596
74 Ga0466722_062666 3300042609 Bacteria 12412
75 IMNBL1DRAFT_c0012748 3300000062 Bacteria 3823
76 Ga0466705_096447 3300042612 Bacteria 32294
77 Ga0466705_179193 3300042612 Bacteria 7849
78 Ga0466723_090796 3300042618 Bacteria 23724
79 Ga0466726_161014 3300042619 Bacteria 1523
80 Ga0466728_192580 3300042620 Bacteria 10511
81 Ga0160469_100604 3300012824 Bacteria 14415
82 Ga0160433_100678 3300012846 Bacteria 13215
83 Ga0160445_100229 3300012847 Bacteria 40847
84 Ga0466696_037072 3300042596 Bacteria 13930
85 Ga0466696_095930 3300042596 Bacteria 3206
86 Ga0466729_227725 3300042621 Bacteria 4095
87 Ga0466735_053155 3300042624 Bacteria 1807
88 Ga0466703_210758 3300042636 Bacteria 2452
89 Ga0466704_352796 3300042643 Bacteria 3086
90 Ga0466709_044971 3300042648 Bacteria 10751
91 Ga0466727_137368 3300042655 Bacteria 15897
92 Ga0466701_102904 3300042598 Bacteria 15591
93 Ga0466714_001570 3300042603 Bacteria 47055
94 Ga0466722_221028 3300042609 Bacteria 5942
95 IMNBL1DRAFT_c0001607 3300000062 Bacteria 16748
96 Ga0068302_10095672 3300005071 Bacteria 1277
97 Ga0466705_325889 3300042612 Bacteria 2673
98 Ga0466715_242562 3300042616 Bacteria 39443
99 Ga0466715_604876 3300042616 Bacteria 36456
100 Ga0466723_178619 3300042618 Bacteria 21638
101 Ga0466726_210074 3300042619 Bacteria 5124
102 Ga0466691_043429 3300042593 Bacteria 4236
103 Ga0466691_206071 3300042593 Bacteria 26570
104 Ga0466694_292217 3300042594 Bacteria 2134
105 Ga0466735_164553 3300042624 Bacteria 5417
106 Ga0466703_330629 3300042636 Bacteria 1656
107 Ga0466704_036478 3300042643 Bacteria 21164
108 Ga0466709_128488 3300042648 Bacteria 12684
109 Ga0466724_46431 3300042649 Unclassified 5667
110 Ga0466706_130997 3300042599 Bacteria 2926
111 Ga0466706_284495 3300042599 Bacteria 4226
112 Ga0466707_012249 3300042601 Bacteria 25629
113 Ga0466707_316107 3300042601 Bacteria 20051
114 Ga0466713_016914 3300042602 Bacteria 10979
115 Ga0466716_294775 3300042605 Bacteria 9847
116 Ga0466722_241799 3300042609 Bacteria 9410
117 JGI24702J35022_10002707 3300002462 Bacteria 10755
118 Ga0466705_192895 3300042612 Bacteria 2202
119 Ga0466705_215835 3300042612 Bacteria 18423
120 Ga0466733_101223 3300042659 Bacteria 57262
121 Ga0466733_188075 3300042659 Bacteria 2192
122 Ga0466711_023837 3300042615 Bacteria 62988
123 Ga0466723_028498 3300042618 Bacteria 28867
124 Ga0123353_10151234 3300010167 Bacteria 3706
125 Ga0466690_395845 3300042590 Bacteria 33359
126 Ga0466692_043899 3300042591 Bacteria 67267
127 Ga0466692_048325 3300042591 Bacteria 14646
128 Ga0466735_167781 3300042624 Bacteria 8315
129 Ga0466703_112325 3300042636 Bacteria 3387
130 Ga0466704_326679 3300042643 Bacteria 4975
131 Ga0466704_362206 3300042643 Bacteria 17907
132 Ga0466727_016365 3300042655 Bacteria 14084
133 Ga0466727_277804 3300042655 Bacteria 5488
134 Ga0466707_382404 3300042601 Unclassified 17120
135 Ga0466719_242108 3300042606 Bacteria 2354
136 Ga0466719_321417 3300042606 Bacteria 1720
137 IMNBL1DRAFT_c0001056 3300000062 Bacteria 21318
138 JGI24699J35502_11134204 3300002509 Bacteria 55998
139 Ga0104048_1000827 3300007143 Bacteria 25782

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012798 Ga0160454_100001 Ga0160454_100001140 323
2 3300012829 Ga0160467_100575 Ga0160467_10057526 323
3 3300012803 Ga0160465_100006 Ga0160465_10000696 326
4 3300012848 Ga0160443_100103 Ga0160443_10010354 329
5 3300012846 Ga0160433_100012 Ga0160433_10001250 333
6 3300042599 Ga0466706_130997 Ga0466706_130997_1344_2354 336
7 3300007153 Ga0104050_1000996 Ga0104050_10009966 337
8 3300012820 Ga0160456_100034 Ga0160456_100034160 339
9 3300012824 Ga0160469_100604 Ga0160469_1006042 339
10 3300012847 Ga0160445_100229 Ga0160445_1002296 339
11 3300012858 Ga0160457_1000384 Ga0160457_100038411 339
12 3300012824 Ga0160469_104121 Ga0160469_1041212 340
13 3300012846 Ga0160433_100678 Ga0160433_1006789 340
14 3300042649 Ga0466724_07335 Ga0466724_07335_11161_12219 341
15 3300042601 Ga0466707_012249 Ga0466707_012249_19708_20790 343
16 3300042609 Ga0466722_062666 Ga0466722_062666_6355_7389 344
17 3300042659 Ga0466733_188075 Ga0466733_188075_766_1806 346
18 3300042599 Ga0466706_284495 Ga0466706_284495_67_1110 347
19 3300042601 Ga0466707_257671 Ga0466707_257671_1443_2501 352
20 iso_pr_bacteria 2579779088 2582236597 352
21 iso_pr_bacteria 2896321640 2896324977 352
22 iso_pr_bacteria 2896330536 2896333419 352
23 iso_pr_bacteria 2896350215 2896353252 352
24 iso_pr_bacteria 2898741527 2898744564 352
25 3300007140 Ga0102740_1000411 Ga0102740_100041111 353
26 3300007143 Ga0104048_1000827 Ga0104048_100082717 353
27 3300042591 Ga0466692_165217 Ga0466692_165217_1815_2876 353
28 3300042598 Ga0466701_014287 Ga0466701_014287_11834_12895 353
29 3300042649 Ga0466724_32925 Ga0466724_32925_49271_50332 353
30 3300042652 Ga0466708_145251 Ga0466708_145251_5790_6851 353
31 3300007085 Ga0104045_1005451 Ga0104045_10054512 354
32 3300042591 Ga0466692_048325 Ga0466692_048325_8780_9844 354
33 3300042598 Ga0466701_029789 Ga0466701_029789_343_1407 354
34 3300042598 Ga0466701_102904 Ga0466701_102904_290_1354 354
35 3300042625 Ga0466730_054806 Ga0466730_054806_323075_324139 354
36 3300042649 Ga0466724_28482 Ga0466724_28482_4661_5725 354
37 3300042649 Ga0466724_46431 Ga0466724_46431_4525_5589 354
38 iso_pr_bacteria 2590828803 2592927811 354
39 iso_pr_bacteria 2820762746 2820764855 354
40 3300002509 JGI24699J35502_11134204 JGI24699J35502_1113420418 355
41 3300042612 Ga0466705_192895 Ga0466705_192895_173_1240 355
42 3300042655 Ga0466727_137368 Ga0466727_137368_4016_5083 355
43 3300002931 CVPL010W_10003257 CVPL010W_1000325714 356
44 3300012829 Ga0160467_100018 Ga0160467_10001862 357
45 3300042616 Ga0466715_111704 Ga0466715_111704_6196_7269 357
46 3300042609 Ga0466722_241799 Ga0466722_241799_7631_8737 358
47 3300042618 Ga0466723_090796 Ga0466723_090796_14132_15208 358
48 3300042620 Ga0466728_215085 Ga0466728_215085_31_1107 358
49 3300000062 IMNBL1DRAFT_c0001607 IMNBL1DRAFT_00016072 360
50 3300042624 Ga0466735_095197 Ga0466735_095197_237_1340 360
51 3300000062 IMNBL1DRAFT_c0001056 IMNBL1DRAFT_000105611 361
52 3300042605 Ga0466716_294775 Ga0466716_294775_6998_8086 362
53 3300042599 Ga0466706_101829 Ga0466706_101829_7379_8479 366
54 3300042599 Ga0466706_219061 Ga0466706_219061_3968_5068 366
55 3300042602 Ga0466713_084333 Ga0466713_084333_3410_4510 366
56 3300042602 Ga0466713_091524 Ga0466713_091524_2527_3627 366
57 3300042603 Ga0466714_001570 Ga0466714_001570_35182_36282 366
58 3300042612 Ga0466705_325889 Ga0466705_325889_1434_2534 366
59 3300042616 Ga0466715_624205 Ga0466715_624205_13620_14720 366
60 3300005083 Ga0068305_10048086 Ga0068305_100480868 367
61 3300042593 Ga0466691_062738 Ga0466691_062738_1200_2303 367
62 3300042596 Ga0466696_050799 Ga0466696_050799_4005_5108 367
63 3300042601 Ga0466707_316107 Ga0466707_316107_11278_12381 367
64 3300042601 Ga0466707_382404 Ga0466707_382404_5024_6127 367
65 3300042606 Ga0466719_321417 Ga0466719_321417_523_1626 367
66 3300042619 Ga0466726_161014 Ga0466726_161014_54_1157 367
67 3300042619 Ga0466726_210074 Ga0466726_210074_3082_4185 367
68 3300042624 Ga0466735_053155 Ga0466735_053155_418_1521 367
69 3300042643 Ga0466704_059884 Ga0466704_059884_215_1318 367
70 3300042655 Ga0466727_016365 Ga0466727_016365_8325_9428 367
71 3300042655 Ga0466727_277804 Ga0466727_277804_885_1988 367
72 2225789004 2227550760 2228080077 368
73 3300000062 IMNBL1DRAFT_c0012748 IMNBL1DRAFT_00127484 368
74 3300005071 Ga0068302_10095672 Ga0068302_100956721 368
75 3300005071 Ga0068302_10125204 Ga0068302_101252043 368
76 3300042590 Ga0466690_395845 Ga0466690_395845_18677_19783 368
77 3300042591 Ga0466692_096609 Ga0466692_096609_414_1520 368
78 3300042593 Ga0466691_043429 Ga0466691_043429_703_1809 368
79 3300042593 Ga0466691_206071 Ga0466691_206071_5823_6929 368
80 3300042596 Ga0466696_095930 Ga0466696_095930_231_1337 368
81 3300042596 Ga0466696_173954 Ga0466696_173954_4566_5672 368
82 3300042601 Ga0466707_078274 Ga0466707_078274_1110_2216 368
83 3300042601 Ga0466707_235811 Ga0466707_235811_7388_8494 368
84 3300042601 Ga0466707_309055 Ga0466707_309055_17_1123 368
85 3300042601 Ga0466707_345716 Ga0466707_345716_191_1297 368
86 3300042605 Ga0466716_100304 Ga0466716_100304_20426_21532 368
87 3300042606 Ga0466719_026084 Ga0466719_026084_6287_7393 368
88 3300042609 Ga0466722_221028 Ga0466722_221028_2894_4000 368
89 3300042612 Ga0466705_215835 Ga0466705_215835_8177_9283 368
90 3300042615 Ga0466711_023837 Ga0466711_023837_27988_29094 368
91 3300042616 Ga0466715_150026 Ga0466715_150026_7370_8476 368
92 3300042618 Ga0466723_028498 Ga0466723_028498_5319_6425 368
93 3300042618 Ga0466723_178619 Ga0466723_178619_16305_17411 368
94 3300042620 Ga0466728_241856 Ga0466728_241856_959_2065 368
95 3300042621 Ga0466729_227725 Ga0466729_227725_1053_2159 368
96 3300042624 Ga0466735_029769 Ga0466735_029769_136_1242 368
97 3300042624 Ga0466735_147767 Ga0466735_147767_309_1415 368
98 3300042636 Ga0466703_210758 Ga0466703_210758_488_1594 368
99 3300042648 Ga0466709_044971 Ga0466709_044971_6205_7311 368
100 3300042648 Ga0466709_128488 Ga0466709_128488_1985_3091 368
101 3300042659 Ga0466733_101223 Ga0466733_101223_20314_21420 368
102 3300002462 JGI24702J35022_10002707 JGI24702J35022_100027075 369
103 3300042591 Ga0466692_103340 Ga0466692_103340_4619_5728 369
104 3300042596 Ga0466696_151110 Ga0466696_151110_26606_27715 369
105 3300042600 Ga0466700_387454 Ga0466700_387454_1118_2227 369
106 3300042605 Ga0466716_152838 Ga0466716_152838_1572_2681 369
107 3300042612 Ga0466705_096447 Ga0466705_096447_25592_26701 369
108 3300042612 Ga0466705_179193 Ga0466705_179193_6646_7755 369
109 3300042616 Ga0466715_521826 Ga0466715_521826_18153_19262 369
110 3300042616 Ga0466715_604876 Ga0466715_604876_34775_35884 369
111 3300042620 Ga0466728_192580 Ga0466728_192580_8478_9587 369
112 3300042623 Ga0466734_127602 Ga0466734_127602_363_1472 369
113 3300042624 Ga0466735_164553 Ga0466735_164553_1624_2733 369
114 3300042636 Ga0466703_330629 Ga0466703_330629_69_1178 369
115 3300042643 Ga0466704_051515 Ga0466704_051515_2202_3311 369
116 3300042643 Ga0466704_260868 Ga0466704_260868_10152_11261 369
117 3300042643 Ga0466704_326679 Ga0466704_326679_796_1905 369
118 3300042643 Ga0466704_362206 Ga0466704_362206_6249_7358 369
119 3300042648 Ga0466709_203051 Ga0466709_203051_1554_2663 369
120 3300007085 Ga0104045_1001911 Ga0104045_10019116 370
121 3300042596 Ga0466696_037072 Ga0466696_037072_1874_2986 370
122 3300042618 Ga0466723_147651 Ga0466723_147651_4293_5405 370
123 3300042619 Ga0466726_411516 Ga0466726_411516_116_1228 370
124 3300042636 Ga0466703_112325 Ga0466703_112325_2216_3328 370
125 3300042643 Ga0466704_019328 Ga0466704_019328_7718_8830 370
126 3300042643 Ga0466704_030869 Ga0466704_030869_1283_2395 370
127 iso_pr_bacteria 2910926975 2910928205 370
128 3300042590 Ga0466690_013407 Ga0466690_013407_10470_11585 371
129 3300042602 Ga0466713_091714 Ga0466713_091714_163662_164777 371
130 3300042606 Ga0466719_242108 Ga0466719_242108_192_1307 371
131 iso_pr_bacteria 2695420931 2698110912 371
132 iso_pr_bacteria 2820778767 2820779492 371
133 iso_pr_bacteria 2940193328 2940195191 371
134 iso_pr_bacteria 2940336608 2940338493 371
135 3300010167 Ga0123353_10151234 Ga0123353_101512342 372
136 iso_pr_bacteria 2695420317 2695486839 372
137 iso_pr_bacteria 2873600114 2873602099 372
138 iso_pr_bacteria 2873610414 2873612460 372
139 iso_pr_bacteria 8100157865 8100158696 372
140 3300042591 Ga0466692_043899 Ga0466692_043899_57712_58833 373
141 3300042602 Ga0466713_077407 Ga0466713_077407_841_1962 373
142 3300042615 Ga0466711_354371 Ga0466711_354371_572_1693 373
143 3300042624 Ga0466735_013173 Ga0466735_013173_1499_2620 373
144 3300042594 Ga0466694_292217 Ga0466694_292217_544_1668 374
145 3300042624 Ga0466735_167781 Ga0466735_167781_1047_2171 374
146 iso_pr_bacteria 2967483437 2967484342 374
147 3300009784 Ga0123357_10055779 Ga0123357_100557792 375
148 3300042596 Ga0466696_400723 Ga0466696_400723_576_1706 376
149 3300042624 Ga0466735_197399 Ga0466735_197399_1268_2398 376
150 3300042636 Ga0466703_159768 Ga0466703_159768_74_1222 382
151 3300012837 Ga0160455_100062 Ga0160455_100062115 390
152 3300042616 Ga0466715_242562 Ga0466715_242562_13375_14547 390
153 3300042602 Ga0466713_016914 Ga0466713_016914_7356_8534 392
154 3300042643 Ga0466704_036478 Ga0466704_036478_7765_8943 392
155 3300042601 Ga0466707_163288 Ga0466707_163288_714_1913 399
156 3300042643 Ga0466704_352796 Ga0466704_352796_565_1791 408

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 8 67 0.96
PF10609 ParA NUBPL iron-transfer P-loop NTPase 99 347 0.93
PF02374 ArsA_ATPase Anion-transporting ATPase 105 138 0.89
PF09140 MipZ ATPase MipZ 102 146 0.82
PF13614 AAA_31 AAA domain 101 245 0.79
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 103 323 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.