Protein Family IF09478

Metagenome Isolate
152 Members
52 Samples
135 Scaffolds
217.53 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_351171|Ga0466704_351171_1101_1766
Length
221 aa
Sequence
MRTRYDEQLAILNSELIEMGALVEYAITKAVTALKGRDVESAEEVIQSDRVIDEKEKEIESLCLKLILFEQPVASDLRQVSAALKMITDLERVGDHAADISELCVYMSGNSGNEHITNWTRMRDMASAATKMLTDAIDAFVKRDPALAESVMSHDDVVDDLFDEVKRDLIRLIREDARNGEQAIDLLQIAKYLERIGDHAVNIAEWVIFSITGVHKDTQVL

📊 Sample Types

Isolate 11.2%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.5%
Termitidae 25.5%
Kalotermitidae 23.5%
Termopsidae 7.8%
Rhinotermitidae 5.9%
Stratiomyidae 3.9%
Passalidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
2 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
7 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
8 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
17 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
18 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
23 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
24 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
52 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_210812 3300042636 Bacteria 2038
2 Ga0123355_10834887 3300009826 Bacteria 1018
3 Ga0123356_10068072 3300010049 Bacteria 3335
4 Ga0123356_10952135 3300010049 Bacteria 1029
5 Ga0123356_11102424 3300010049 Bacteria 962
6 Ga0123353_10074966 3300010167 Unclassified 5438
7 Ga0123353_10805866 3300010167 Bacteria 1296
8 Ga0466723_264624 3300042618 Bacteria 10157
9 Ga0466700_007099 3300042600 Bacteria 1018
10 Ga0466700_196512 3300042600 Bacteria 1206
11 Ga0466719_014579 3300042606 Bacteria 2880
12 Ga0466719_142314 3300042606 Bacteria 2599
13 Ga0466721_135467 3300042608 Bacteria 15102
14 Ga0466692_027993 3300042591 Bacteria 48434
15 IMNBL1DRAFT_c0000504 3300000062 Bacteria 32511
16 IMNBL1DRAFT_c0000594 3300000062 Bacteria 29101
17 IMNBL1DRAFT_c0003108 3300000062 Bacteria 10953
18 IMNBL1DRAFT_c0046611 3300000062 Bacteria 1406
19 JGI24705J35276_12191409 3300002504 Bacteria 1474
20 Ga0466704_308416 3300042643 Bacteria 20776
21 Ga0466704_351171 3300042643 Bacteria 2232
22 Ga0466709_131732 3300042648 Bacteria 2768
23 Ga0466727_036485 3300042655 Bacteria 9446
24 Ga0123355_10354228 3300009826 Bacteria 1941
25 Ga0123356_10625059 3300010049 Bacteria 1243
26 Ga0123356_10867557 3300010049 Bacteria 1074
27 Ga0123353_10302251 3300010167 Bacteria 2441
28 Ga0466715_204222 3300042616 Bacteria 10036
29 Ga0466706_025300 3300042599 Bacteria 10536
30 Ga0466719_336472 3300042606 Bacteria 54006
31 Ga0466722_006451 3300042609 Bacteria 12524
32 Ga0466705_322267 3300042612 Bacteria 3028
33 Ga0415639_040245 3300038395 Bacteria 4619
34 IMNBL1DRAFT_c0000462 3300000062 Bacteria 34022
35 IMNBL1DRAFT_c0002887 3300000062 Bacteria 11516
36 Ga0466735_208104 3300042624 Bacteria 3477
37 Ga0466703_154400 3300042636 Bacteria 7932
38 Ga0466704_386847 3300042643 Bacteria 1049
39 Ga0466704_609914 3300042643 Unclassified 16061
40 Ga0466708_250540 3300042652 Bacteria 15125
41 Ga0123353_10004613 3300010167 Bacteria 17783
42 Ga0466723_145743 3300042618 Bacteria 34862
43 Ga0466723_331935 3300042618 Bacteria 4212
44 Ga0466726_025579 3300042619 Bacteria 14087
45 Ga0466707_015371 3300042601 Bacteria 12702
46 Ga0466719_358405 3300042606 Bacteria 3026
47 Ga0466722_000591 3300042609 Bacteria 5776
48 Ga0466705_244477 3300042612 Bacteria 1475
49 Ga0466705_353146 3300042612 Bacteria 2129
50 Ga0415639_087093 3300038395 Bacteria 4419
51 Ga0466690_103477 3300042590 Bacteria 27602
52 Ga0466693_293462 3300042592 Bacteria 1119
53 Ga0466696_272889 3300042596 Bacteria 6114
54 2227613519 2225789004 Bacteria 2243
55 JGI24703J35330_11748491 3300002501 Bacteria 17536
56 Ga0466729_203937 3300042621 Bacteria 1664
57 Ga0466703_318838 3300042636 Bacteria 3396
58 Ga0466704_371810 3300042643 Bacteria 9952
59 Ga0123355_10224294 3300009826 Bacteria 2696
60 Ga0123353_10053283 3300010167 Bacteria 6466
61 Ga0466728_280537 3300042620 Bacteria 29667
62 Ga0466705_103257 3300042612 Bacteria 29091
63 Ga0466691_079916 3300042593 Bacteria 13574
64 2227283592 2225789004 Bacteria 1255
65 2227494070 2225789004 Bacteria 20271
66 Ga0068302_10066077 3300005071 Bacteria 15811
67 Ga0466704_293971 3300042643 Bacteria 1585
68 Ga0123355_10002682 3300009826 Bacteria 25237
69 Ga0123355_10007575 3300009826 Unclassified 16290
70 Ga0123353_10000230 3300010167 Bacteria 70628
71 Ga0123353_10373958 3300010167 Bacteria 2135
72 Ga0466728_189537 3300042620 Bacteria 1453
73 Ga0466729_046736 3300042621 Bacteria 36013
74 Ga0466706_213575 3300042599 Bacteria 1282
75 Ga0466706_224511 3300042599 Bacteria 8128
76 Ga0466707_077608 3300042601 Bacteria 8988
77 Ga0466722_162998 3300042609 Bacteria 2940
78 Ga0415639_000016 3300038395 Bacteria 54558
79 Ga0415639_006863 3300038395 Bacteria 34048
80 Ga0466690_179867 3300042590 Bacteria 9633
81 Ga0466690_232357 3300042590 Bacteria 1366
82 IMNBL1DRAFT_c0004372 3300000062 Bacteria 8525
83 Ga0466703_276607 3300042636 Bacteria 7277
84 Ga0466708_254521 3300042652 Bacteria 46045
85 Ga0466708_447127 3300042652 Bacteria 1416
86 Ga0123355_10133431 3300009826 Bacteria 3820
87 Ga0123355_10358181 3300009826 Bacteria 1925
88 Ga0123356_10000423 3300010049 Bacteria 48180
89 Ga0123356_10947859 3300010049 Bacteria 1032
90 Ga0123353_10371589 3300010167 Bacteria 2143
91 Ga0123353_11050647 3300010167 Bacteria 1088
92 Ga0123353_11060179 3300010167 Bacteria 1081
93 Ga0466728_047370 3300042620 Bacteria 1402
94 Ga0466706_170801 3300042599 Unclassified 1141
95 Ga0466706_175156 3300042599 Bacteria 30160
96 Ga0466707_350391 3300042601 Bacteria 1004
97 Ga0466719_411541 3300042606 Bacteria 5788
98 Ga0415639_056534 3300038395 Bacteria 2314
99 Ga0466696_112817 3300042596 Bacteria 1360
100 Ga0466696_152839 3300042596 Bacteria 12178
101 IMNBL1DRAFT_c0044026 3300000062 Bacteria 1471
102 Ga0072941_1341687 3300005201 Unclassified 4852
103 Ga0466702_319029 3300042635 Bacteria 39449
104 Ga0466708_067650 3300042652 Bacteria 28053
105 Ga0123355_10021615 3300009826 Bacteria 10301
106 Ga0123355_10033948 3300009826 Bacteria 8287
107 Ga0123355_10195651 3300009826 Bacteria 2966
108 Ga0123356_10000039 3300010049 Bacteria 138853
109 Ga0123353_10071396 3300010167 Bacteria 5578
110 Ga0123353_10387502 3300010167 Bacteria 2087
111 Ga0123353_10541536 3300010167 Bacteria 1682
112 Ga0123354_10040001 3300010882 Bacteria 7261
113 Ga0466715_118933 3300042616 Bacteria 4816
114 Ga0466706_109913 3300042599 Bacteria 2448
115 Ga0466706_183783 3300042599 Bacteria 28869
116 Ga0466700_098243 3300042600 Bacteria 1267
117 Ga0466707_083504 3300042601 Bacteria 1329
118 Ga0466719_120555 3300042606 Bacteria 8797
119 Ga0466719_165163 3300042606 Bacteria 6984
120 Ga0466719_310483 3300042606 Bacteria 1326
121 Ga0466721_258336 3300042608 Bacteria 21781
122 Ga0466722_232912 3300042609 Bacteria 13128
123 Ga0466705_143755 3300042612 Bacteria 4604
124 Ga0415639_000656 3300038395 Bacteria 9483
125 Ga0466727_303889 3300042655 Bacteria 1362
126 Ga0123355_10587855 3300009826 Bacteria 1327
127 Ga0123353_10658318 3300010167 Bacteria 1481
128 Ga0123353_10828406 3300010167 Bacteria 1272
129 Ga0123354_10167073 3300010882 Bacteria 2581
130 Ga0466705_520748 3300042612 Bacteria 5715
131 Ga0466715_455412 3300042616 Bacteria 5786
132 Ga0466728_076476 3300042620 Bacteria 2635
133 Ga0466728_128678 3300042620 Unclassified 1044
134 Ga0466707_188343 3300042601 Bacteria 5373
135 Ga0466714_093038 3300042603 Bacteria 4466

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_293462 Ga0466693_293462_294_935 198
2 3300042600 Ga0466700_098243 Ga0466700_098243_159_806 198
3 3300042612 Ga0466705_353146 Ga0466705_353146_1160_1816 199
4 3300042643 Ga0466704_371810 Ga0466704_371810_3502_4158 199
5 3300042603 Ga0466714_093038 Ga0466714_093038_3707_4309 200
6 3300009826 Ga0123355_10007575 Ga0123355_1000757511 204
7 3300009826 Ga0123355_10354228 Ga0123355_103542282 204
8 3300009826 Ga0123355_10834887 Ga0123355_108348872 204
9 3300000062 IMNBL1DRAFT_c0046611 IMNBL1DRAFT_00466112 206
10 3300042606 Ga0466719_014579 Ga0466719_014579_389_1012 207
11 3300010882 Ga0123354_10167073 Ga0123354_101670734 208
12 3300042606 Ga0466719_310483 Ga0466719_310483_267_893 208
13 3300042643 Ga0466704_308416 Ga0466704_308416_16074_16730 209
14 3300009826 Ga0123355_10358181 Ga0123355_103581812 210
15 3300042636 Ga0466703_318838 Ga0466703_318838_2004_2642 212
16 3300009826 Ga0123355_10224294 Ga0123355_102242943 213
17 3300042600 Ga0466700_196512 Ga0466700_196512_254_895 213
18 iso_pr_bacteria 2820713307 2820714508 214
19 3300009826 Ga0123355_10195651 Ga0123355_101956512 215
20 3300038395 Ga0415639_006863 Ga0415639_006863_12369_13016 215
21 3300038395 Ga0415639_040245 Ga0415639_040245_890_1537 215
22 3300010167 Ga0123353_10541536 Ga0123353_105415363 216
23 3300010167 Ga0123353_10828406 Ga0123353_108284062 216
24 iso_pr_bacteria 2820823448 2820825280 216
25 3300009826 Ga0123355_10021615 Ga0123355_100216158 217
26 3300009826 Ga0123355_10133431 Ga0123355_101334312 217
27 3300009826 Ga0123355_10587855 Ga0123355_105878552 217
28 3300038395 Ga0415639_056534 Ga0415639_056534_425_1078 217
29 3300042600 Ga0466700_007099 Ga0466700_007099_89_742 217
30 iso_pr_bacteria 2820282995 2820283692 217
31 iso_pr_bacteria 2820573558 2820573746 217
32 iso_pr_bacteria 2820598593 2820599608 217
33 iso_pr_bacteria 8030337018 8030339414 217
34 2225789004 2227283592 2227735289 218
35 2225789004 2227494070 2227969228 218
36 2225789004 2227613519 2228186987 218
37 3300000062 IMNBL1DRAFT_c0000594 IMNBL1DRAFT_000059410 218
38 3300009826 Ga0123355_10002682 Ga0123355_1000268222 218
39 3300010049 Ga0123356_10000423 Ga0123356_1000042318 218
40 3300010049 Ga0123356_10068072 Ga0123356_100680722 218
41 3300010049 Ga0123356_10625059 Ga0123356_106250591 218
42 3300010049 Ga0123356_10867557 Ga0123356_108675572 218
43 3300010167 Ga0123353_10302251 Ga0123353_103022513 218
44 3300010167 Ga0123353_11060179 Ga0123353_110601792 218
45 3300042590 Ga0466690_103477 Ga0466690_103477_18101_18757 218
46 3300042590 Ga0466690_232357 Ga0466690_232357_532_1188 218
47 3300042593 Ga0466691_079916 Ga0466691_079916_3539_4195 218
48 3300042596 Ga0466696_112817 Ga0466696_112817_86_742 218
49 3300042596 Ga0466696_152839 Ga0466696_152839_3395_4051 218
50 3300042596 Ga0466696_272889 Ga0466696_272889_3851_4507 218
51 3300042599 Ga0466706_109913 Ga0466706_109913_1040_1696 218
52 3300042599 Ga0466706_170801 Ga0466706_170801_348_1004 218
53 3300042599 Ga0466706_175156 Ga0466706_175156_22201_22857 218
54 3300042599 Ga0466706_183783 Ga0466706_183783_14181_14837 218
55 3300042599 Ga0466706_213575 Ga0466706_213575_69_725 218
56 3300042599 Ga0466706_224511 Ga0466706_224511_5284_5940 218
57 3300042601 Ga0466707_083504 Ga0466707_083504_197_853 218
58 3300042601 Ga0466707_188343 Ga0466707_188343_2237_2893 218
59 3300042601 Ga0466707_350391 Ga0466707_350391_199_855 218
60 3300042606 Ga0466719_120555 Ga0466719_120555_6299_6955 218
61 3300042606 Ga0466719_142314 Ga0466719_142314_1905_2561 218
62 3300042606 Ga0466719_165163 Ga0466719_165163_2442_3098 218
63 3300042606 Ga0466719_336472 Ga0466719_336472_40584_41240 218
64 3300042606 Ga0466719_358405 Ga0466719_358405_2344_3000 218
65 3300042606 Ga0466719_411541 Ga0466719_411541_285_941 218
66 3300042608 Ga0466721_135467 Ga0466721_135467_7219_7875 218
67 3300042609 Ga0466722_162998 Ga0466722_162998_1158_1814 218
68 3300042609 Ga0466722_232912 Ga0466722_232912_493_1149 218
69 3300042612 Ga0466705_143755 Ga0466705_143755_1207_1863 218
70 3300042612 Ga0466705_244477 Ga0466705_244477_435_1091 218
71 3300042612 Ga0466705_322267 Ga0466705_322267_1898_2554 218
72 3300042612 Ga0466705_520748 Ga0466705_520748_840_1496 218
73 3300042616 Ga0466715_204222 Ga0466715_204222_6226_6882 218
74 3300042618 Ga0466723_145743 Ga0466723_145743_24211_24867 218
75 3300042618 Ga0466723_264624 Ga0466723_264624_2113_2769 218
76 3300042618 Ga0466723_331935 Ga0466723_331935_223_879 218
77 3300042620 Ga0466728_047370 Ga0466728_047370_597_1253 218
78 3300042620 Ga0466728_076476 Ga0466728_076476_287_943 218
79 3300042620 Ga0466728_128678 Ga0466728_128678_180_836 218
80 3300042620 Ga0466728_280537 Ga0466728_280537_27711_28367 218
81 3300042621 Ga0466729_046736 Ga0466729_046736_3657_4313 218
82 3300042624 Ga0466735_208104 Ga0466735_208104_575_1231 218
83 3300042636 Ga0466703_154400 Ga0466703_154400_3457_4113 218
84 3300042636 Ga0466703_276607 Ga0466703_276607_2969_3625 218
85 3300042643 Ga0466704_609914 Ga0466704_609914_12148_12804 218
86 3300042648 Ga0466709_131732 Ga0466709_131732_1597_2253 218
87 3300042655 Ga0466727_036485 Ga0466727_036485_3482_4138 218
88 iso_pr_bacteria 2585428085 2587834726 218
89 iso_pr_bacteria 2820018428 2820019164 218
90 iso_pr_bacteria 2820080004 2820081861 218
91 iso_pr_bacteria 2820089333 2820091973 218
92 iso_pr_bacteria 2820560510 2820560794 218
93 iso_pr_bacteria 8030343600 8030346639 218
94 3300000062 IMNBL1DRAFT_c0000462 IMNBL1DRAFT_000046232 219
95 3300000062 IMNBL1DRAFT_c0000504 IMNBL1DRAFT_000050419 219
96 3300000062 IMNBL1DRAFT_c0002887 IMNBL1DRAFT_00028874 219
97 3300000062 IMNBL1DRAFT_c0003108 IMNBL1DRAFT_000310812 219
98 3300000062 IMNBL1DRAFT_c0004372 IMNBL1DRAFT_00043727 219
99 3300000062 IMNBL1DRAFT_c0044026 IMNBL1DRAFT_00440262 219
100 3300002504 JGI24705J35276_12191409 JGI24705J35276_121914092 219
101 3300005201 Ga0072941_1341687 Ga0072941_13416872 219
102 3300010049 Ga0123356_10000039 Ga0123356_1000003997 219
103 3300010049 Ga0123356_10947859 Ga0123356_109478592 219
104 3300010167 Ga0123353_10004613 Ga0123353_1000461310 219
105 3300010167 Ga0123353_10053283 Ga0123353_100532835 219
106 3300010167 Ga0123353_10071396 Ga0123353_100713963 219
107 3300010167 Ga0123353_10074966 Ga0123353_100749665 219
108 3300010167 Ga0123353_10371589 Ga0123353_103715892 219
109 3300010167 Ga0123353_10387502 Ga0123353_103875023 219
110 3300010167 Ga0123353_10805866 Ga0123353_108058662 219
111 3300010882 Ga0123354_10040001 Ga0123354_100400014 219
112 3300038395 Ga0415639_000016 Ga0415639_000016_23407_24066 219
113 3300038395 Ga0415639_000656 Ga0415639_000656_2279_2938 219
114 3300042590 Ga0466690_179867 Ga0466690_179867_3006_3665 219
115 3300042601 Ga0466707_015371 Ga0466707_015371_8525_9184 219
116 3300042601 Ga0466707_077608 Ga0466707_077608_130_789 219
117 3300042608 Ga0466721_258336 Ga0466721_258336_15566_16225 219
118 3300042609 Ga0466722_000591 Ga0466722_000591_4213_4872 219
119 3300042609 Ga0466722_006451 Ga0466722_006451_7764_8423 219
120 3300042612 Ga0466705_103257 Ga0466705_103257_22724_23383 219
121 3300042616 Ga0466715_118933 Ga0466715_118933_2295_2954 219
122 3300042616 Ga0466715_455412 Ga0466715_455412_2561_3220 219
123 3300042620 Ga0466728_189537 Ga0466728_189537_156_815 219
124 3300042636 Ga0466703_210812 Ga0466703_210812_891_1550 219
125 3300042643 Ga0466704_386847 Ga0466704_386847_242_901 219
126 3300042652 Ga0466708_250540 Ga0466708_250540_5166_5825 219
127 3300042652 Ga0466708_254521 Ga0466708_254521_17898_18557 219
128 3300042652 Ga0466708_447127 Ga0466708_447127_470_1129 219
129 3300042655 Ga0466727_303889 Ga0466727_303889_689_1348 219
130 iso_pr_bacteria 2820453354 2820453913 219
131 3300005071 Ga0068302_10066077 Ga0068302_1006607715 220
132 3300010049 Ga0123356_10952135 Ga0123356_109521352 220
133 3300010049 Ga0123356_11102424 Ga0123356_111024242 220
134 3300010167 Ga0123353_10000230 Ga0123353_100002301 220
135 3300010167 Ga0123353_10658318 Ga0123353_106583182 220
136 3300038395 Ga0415639_087093 Ga0415639_087093_377_1039 220
137 3300042621 Ga0466729_203937 Ga0466729_203937_245_907 220
138 3300042619 Ga0466726_025579 Ga0466726_025579_5405_6070 221
139 3300042643 Ga0466704_351171 Ga0466704_351171_1101_1766 221
140 iso_pr_bacteria 2820321184 2820322495 221
141 3300042635 Ga0466702_319029 Ga0466702_319029_26562_27230 222
142 iso_pr_bacteria 2820453354 2820455388 222
143 3300010167 Ga0123353_11050647 Ga0123353_110506472 223
144 3300042591 Ga0466692_027993 Ga0466692_027993_17848_18519 223
145 3300042643 Ga0466704_293971 Ga0466704_293971_193_864 223
146 iso_pr_bacteria 2820292184 2820292940 223
147 3300010167 Ga0123353_10373958 Ga0123353_103739582 224
148 3300009826 Ga0123355_10033948 Ga0123355_100339484 225
149 3300042599 Ga0466706_025300 Ga0466706_025300_8826_9506 226
150 3300042652 Ga0466708_067650 Ga0466708_067650_4750_5430 226
151 iso_pr_bacteria 2820387566 2820388206 244
152 3300002501 JGI24703J35330_11748491 JGI24703J35330_1174849110 245

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01895 PhoU PhoU domain 16 103 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.