Protein Family IF09473

Metagenome Isolate
209 Members
63 Samples
194 Scaffolds
231.32 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_342826|Ga0466704_342826_4972_5679
Length
235 aa
Sequence
MWNFQEGEILYFDKPLHWTSFDLINKVRYQISRALKIKKIKVGHAGTLDPLATGVMIVCTGPATKRIEEFQYQTKEYIATLRLGATTPSFDLETEIDHTYPASVTQQQVEQILPQFLGRIEQIPPAFSACKVNGNRAYQLARKGEEVSLQPKTLIIDEIELLDFKPNELKIRVLCSKGTYIRALARDIGQALHSGAHLIALQRTRIGAVTLNDCLSIEQWNSLLFPTSELINNHP

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.2%
Kalotermitidae 22.2%
Unclassified 12.7%
Blattidae 11.1%
Rhinotermitidae 6.3%
Termopsidae 6.3%
Passalidae 4.8%
Hydrophilidae 3.2%
Hodotermitidae 1.6%
Tenebrionidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 208
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
20 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
25 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
37 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3004667792 Bacteroides sp. 519 Isolate Blattidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
46 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 2922326829 Bacteroides sp. 224 Isolate Blattidae
52 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
58 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0004 3300056842 Bacteria 3525959
2 Ga0466699_147168 3300042597 Bacteria 6708
3 Ga0466711_222138 3300042615 Bacteria 34260
4 Ga0466715_006491 3300042616 Bacteria 11353
5 Ga0466728_109323 3300042620 Bacteria 29533
6 Ga0466728_128512 3300042620 Bacteria 23920
7 Ga0466729_205396 3300042621 Bacteria 3342
8 Ga0466735_085612 3300042624 Bacteria 2895
9 Ga0466735_214834 3300042624 Bacteria 4283
10 Ga0466735_232566 3300042624 Bacteria 1422
11 Ga0466703_033925 3300042636 Bacteria 2073
12 Ga0466704_342826 3300042643 Bacteria 7865
13 Ga0466704_458103 3300042643 Bacteria 1213
14 Ga0466707_018219 3300042601 Bacteria 12288
15 Ga0466707_254503 3300042601 Bacteria 6599
16 Ga0466713_049079 3300042602 Bacteria 4529
17 Ga0466716_278312 3300042605 Bacteria 3847
18 Ga0466722_093567 3300042609 Bacteria 6385
19 Ga0466722_094026 3300042609 Bacteria 13311
20 IMNBL1DRAFT_c0000888 3300000062 Bacteria 23268
21 IMNBL1DRAFT_c0001493 3300000062 Bacteria 17437
22 IMNBL1DRAFT_c0001604 3300000062 Bacteria 16784
23 JGI24702J35022_10010884 3300002462 Bacteria 5075
24 JGI24702J35022_10208905 3300002462 Bacteria 1120
25 JGI24705J35276_12092546 3300002504 Bacteria 998
26 JGI24705J35276_12200381 3300002504 Bacteria 1601
27 JGI24699J35502_11133869 3300002509 Bacteria 17597
28 Ga0068302_10227837 3300005071 Bacteria 5498
29 Ga0123357_10010939 3300009784 Bacteria 11585
30 Ga0123357_10036964 3300009784 Bacteria 6645
31 Ga0123354_10006263 3300010882 Bacteria 17632
32 Ga0466690_017517 3300042590 Bacteria 22678
33 Ga0466692_147406 3300042591 Bacteria 6178
34 Ga0466694_199834 3300042594 Bacteria 2670
35 Ga0466696_333016 3300042596 Bacteria 3966
36 Ga0466711_236413 3300042615 Bacteria 6587
37 Ga0466723_231997 3300042618 Bacteria 12187
38 Ga0466728_267319 3300042620 Bacteria 36275
39 Ga0466704_192038 3300042643 Bacteria 6378
40 Ga0466708_031780 3300042652 Bacteria 13567
41 Ga0466725_160865 3300042654 Bacteria 5721
42 Ga0466707_056811 3300042601 Bacteria 7083
43 Ga0466707_395101 3300042601 Bacteria 2156
44 Ga0466713_068672 3300042602 Bacteria 133468
45 Ga0466716_020808 3300042605 Bacteria 1257
46 Ga0466716_197148 3300042605 Bacteria 3798
47 Ga0466719_161072 3300042606 Bacteria 2803
48 Ga0466719_368693 3300042606 Bacteria 8795
49 Ga0466722_077297 3300042609 Bacteria 12633
50 Ga0123357_10022969 3300009784 Bacteria 8371
51 Ga0123357_10401724 3300009784 Bacteria 1246
52 Ga0466705_016778 3300042612 Bacteria 7761
53 Ga0466705_342178 3300042612 Bacteria 42153
54 Ga0466690_169035 3300042590 Bacteria 8286
55 Ga0466692_076121 3300042591 Bacteria 39976
56 Ga0466696_398566 3300042596 Bacteria 10191
57 Ga0466701_015645 3300042598 Bacteria 10177
58 Ga0466715_187702 3300042616 Bacteria 5301
59 Ga0466728_324686 3300042620 Bacteria 4445
60 Ga0466735_153690 3300042624 Bacteria 1096
61 Ga0466704_136900 3300042643 Bacteria 8133
62 Ga0466704_170080 3300042643 Bacteria 45113
63 Ga0466727_169478 3300042655 Bacteria 3320
64 Ga0466707_018443 3300042601 Bacteria 12796
65 Ga0466713_033020 3300042602 Bacteria 4539
66 Ga0466713_146312 3300042602 Bacteria 2211
67 Ga0466719_515918 3300042606 Bacteria 12958
68 2227560735 2225789004 Bacteria 14480
69 IMNBL1DRAFT_c0000013 3300000062 Bacteria 180832
70 IMNBL1DRAFT_c0006815 3300000062 Bacteria 6154
71 Ga0123357_10241058 3300009784 Bacteria 1958
72 Ga0123356_10880786 3300010049 Bacteria 1066
73 Ga0123354_10006992 3300010882 Bacteria 16870
74 Ga0123354_10052158 3300010882 Bacteria 6165
75 Ga0466733_049019 3300042659 Bacteria 34247
76 Ga0466690_119681 3300042590 Bacteria 18648
77 Ga0466692_202977 3300042591 Bacteria 25725
78 Ga0466715_022831 3300042616 Bacteria 11871
79 Ga0466728_338284 3300042620 Bacteria 92891
80 Ga0466734_082022 3300042623 Bacteria 1245
81 Ga0466735_090008 3300042624 Bacteria 5695
82 Ga0466735_107145 3300042624 Bacteria 11894
83 Ga0466703_048088 3300042636 Bacteria 40180
84 Ga0466703_223832 3300042636 Bacteria 6905
85 Ga0466703_320358 3300042636 Bacteria 44545
86 Ga0466704_023620 3300042643 Bacteria 4292
87 Ga0466704_259836 3300042643 Bacteria 5954
88 Ga0466709_052166 3300042648 Bacteria 30375
89 Ga0466725_317005 3300042654 Bacteria 23315
90 Ga0466727_116386 3300042655 Bacteria 8479
91 Ga0466716_241806 3300042605 Bacteria 2649
92 Ga0466722_143944 3300042609 Bacteria 23666
93 Ga0466722_252821 3300042609 Bacteria 235840
94 Ga0466697_007298 3300042611 Bacteria 1776
95 2227422476 2225789004 Bacteria 5620
96 Ga0068305_10171143 3300005083 Bacteria 3163
97 Ga0068305_10460416 3300005083 Bacteria 1762
98 Ga0123357_10006248 3300009784 Bacteria 14478
99 Ga0123353_10026616 3300010167 Bacteria 8841
100 Ga0123353_10055791 3300010167 Bacteria 6322
101 Ga0466690_146535 3300042590 Bacteria 8131
102 Ga0466693_421468 3300042592 Bacteria 2705
103 Ga0466691_111298 3300042593 Bacteria 6981
104 Ga0466711_176561 3300042615 Bacteria 3560
105 Ga0466711_463674 3300042615 Bacteria 2441
106 Ga0466715_119466 3300042616 Bacteria 7186
107 Ga0466715_274255 3300042616 Bacteria 20116
108 Ga0466715_546483 3300042616 Bacteria 18843
109 Ga0466723_153364 3300042618 Bacteria 4952
110 Ga0466726_005269 3300042619 Bacteria 1171
111 Ga0466728_398353 3300042620 Bacteria 2070
112 Ga0466729_135755 3300042621 Bacteria 9679
113 Ga0466703_005407 3300042636 Bacteria 8249
114 Ga0466703_156231 3300042636 Bacteria 8237
115 Ga0466704_096675 3300042643 Bacteria 5682
116 Ga0466704_540065 3300042643 Bacteria 11117
117 Ga0466708_080881 3300042652 Bacteria 15574
118 Ga0466708_246412 3300042652 Bacteria 11145
119 Ga0466727_270580 3300042655 Bacteria 6936
120 Ga0466701_053913 3300042598 Bacteria 7349
121 Ga0466706_260080 3300042599 Bacteria 1433
122 Ga0466700_115552 3300042600 Bacteria 26876
123 Ga0466707_271224 3300042601 Bacteria 9147
124 Ga0466719_494120 3300042606 Bacteria 8489
125 2227072440 2225789003 Bacteria 13102
126 2227474342 2225789004 Bacteria 4724
127 JGI24702J35022_10026334 3300002462 Bacteria 3133
128 JGI24699J35502_11134157 3300002509 Bacteria 40557
129 Ga0123357_10003501 3300009784 Bacteria 18049
130 Ga0123357_10015250 3300009784 Bacteria 10074
131 Ga0123357_10022776 3300009784 Bacteria 8404
132 Ga0466705_320045 3300042612 Bacteria 5232
133 Ga0466690_296510 3300042590 Bacteria 22089
134 Ga0466692_157590 3300042591 Bacteria 38629
135 Ga0466711_086368 3300042615 Bacteria 13336
136 Ga0466715_127650 3300042616 Bacteria 20292
137 Ga0466715_172001 3300042616 Bacteria 21115
138 Ga0466726_442562 3300042619 Bacteria 24934
139 Ga0466728_432805 3300042620 Bacteria 1432
140 Ga0466703_030205 3300042636 Bacteria 6649
141 Ga0466703_067681 3300042636 Bacteria 6109
142 Ga0466704_037901 3300042643 Bacteria 18687
143 Ga0466727_241532 3300042655 Bacteria 2957
144 Ga0466700_154339 3300042600 Bacteria 2063
145 Ga0466716_054306 3300042605 Bacteria 5565
146 2227450250 2225789004 Unclassified 5425
147 2227467416 2225789004 Bacteria 5073
148 JGI24695J34938_10071875 3300002450 Bacteria 1444
149 Ga0123357_10000562 3300009784 Bacteria 36621
150 Ga0123357_10003895 3300009784 Bacteria 17318
151 Ga0123354_10131301 3300010882 Bacteria 3162
152 Ga0466733_110309 3300042659 Bacteria 6828
153 Ga0466693_041412 3300042592 Bacteria 1669
154 Ga0466691_006494 3300042593 Bacteria 13020
155 Ga0466728_246698 3300042620 Bacteria 1318
156 Ga0466729_281255 3300042621 Bacteria 2041
157 Ga0466734_159763 3300042623 Bacteria 1472
158 Ga0466735_056602 3300042624 Bacteria 2990
159 Ga0466708_233940 3300042652 Bacteria 9713
160 Ga0466727_219343 3300042655 Bacteria 4173
161 Ga0466700_093178 3300042600 Bacteria 6227
162 Ga0466713_058280 3300042602 Bacteria 24824
163 Ga0466719_025880 3300042606 Bacteria 2896
164 Ga0466719_302108 3300042606 Bacteria 2582
165 2227626313 2225789004 Bacteria 2152
166 JGI24699J35502_11134209 3300002509 Bacteria 59622
167 JGI24696J40584_12960435 3300002834 Bacteria 7230
168 Ga0123354_10007441 3300010882 Bacteria 16489
169 Ga0123354_10020461 3300010882 Bacteria 10410
170 Ga0123354_10155911 3300010882 Bacteria 2739
171 Ga0466705_005625 3300042612 Bacteria 36078
172 Ga0466690_083768 3300042590 Bacteria 25653
173 Ga0466690_337300 3300042590 Bacteria 19939
174 Ga0466692_086870 3300042591 Bacteria 4509
175 Ga0466691_181414 3300042593 Bacteria 4157
176 Ga0466705_491715 3300042612 Bacteria 12471
177 Ga0466718_152551 3300042617 Bacteria 1756
178 Ga0466726_057843 3300042619 Bacteria 10697
179 Ga0466735_016838 3300042624 Bacteria 28411
180 Ga0466735_229986 3300042624 Bacteria 3504
181 Ga0466703_396203 3300042636 Bacteria 3223
182 Ga0466706_203102 3300042599 Bacteria 35690
183 Ga0466700_054125 3300042600 Bacteria 6945
184 Ga0466700_491849 3300042600 Bacteria 1441
185 Ga0466707_106749 3300042601 Bacteria 20341
186 Ga0466707_200784 3300042601 Bacteria 7523
187 Ga0466707_371599 3300042601 Bacteria 2877
188 Ga0466719_434400 3300042606 Bacteria 1114
189 Ga0466722_148628 3300042609 Bacteria 32360
190 Ga0466722_197521 3300042609 Bacteria 3270
191 JGI24699J35502_11134064 3300002509 Bacteria 27953
192 Ga0123357_10037229 3300009784 Bacteria 6620
193 Ga0123357_10039121 3300009784 Bacteria 6459
194 Ga0123354_10002273 3300010882 Bacteria 25118

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_278312 Ga0466716_278312_1449_2138 221
2 3300042618 Ga0466723_231997 Ga0466723_231997_9991_10659 222
3 3300042600 Ga0466700_054125 Ga0466700_054125_4090_4761 223
4 3300042619 Ga0466726_057843 Ga0466726_057843_3732_4403 223
5 3300042655 Ga0466727_241532 Ga0466727_241532_767_1438 223
6 3300002450 JGI24695J34938_10071875 JGI24695J34938_100718752 224
7 3300005071 Ga0068302_10227837 Ga0068302_102278371 224
8 3300009784 Ga0123357_10022776 Ga0123357_100227766 224
9 3300009784 Ga0123357_10022969 Ga0123357_100229692 224
10 3300009784 Ga0123357_10036964 Ga0123357_100369645 224
11 3300009784 Ga0123357_10039121 Ga0123357_100391216 224
12 3300010167 Ga0123353_10026616 Ga0123353_100266164 224
13 3300010882 Ga0123354_10155911 Ga0123354_101559112 224
14 3300042601 Ga0466707_371599 Ga0466707_371599_367_1041 224
15 3300042609 Ga0466722_093567 Ga0466722_093567_1584_2258 224
16 3300042609 Ga0466722_197521 Ga0466722_197521_404_1078 224
17 2225789004 2227422476 2227863375 225
18 2225789004 2227450250 2227887317 225
19 2225789004 2227626313 2228207952 225
20 3300002509 JGI24699J35502_11134157 JGI24699J35502_1113415737 225
21 3300009784 Ga0123357_10010939 Ga0123357_1001093910 225
22 3300042590 Ga0466690_337300 Ga0466690_337300_1462_2139 225
23 3300042591 Ga0466692_076121 Ga0466692_076121_15815_16492 225
24 3300042606 Ga0466719_494120 Ga0466719_494120_3491_4168 225
25 3300042609 Ga0466722_077297 Ga0466722_077297_2890_3567 225
26 3300042616 Ga0466715_022831 Ga0466715_022831_9164_9841 225
27 3300000062 IMNBL1DRAFT_c0000888 IMNBL1DRAFT_000088814 226
28 3300000062 IMNBL1DRAFT_c0001493 IMNBL1DRAFT_00014936 226
29 3300009784 Ga0123357_10000562 Ga0123357_1000056231 226
30 3300009784 Ga0123357_10003501 Ga0123357_1000350113 226
31 3300009784 Ga0123357_10003895 Ga0123357_1000389520 226
32 3300010167 Ga0123353_10055791 Ga0123353_100557915 226
33 3300042596 Ga0466696_398566 Ga0466696_398566_8827_9507 226
34 3300042600 Ga0466700_154339 Ga0466700_154339_69_749 226
35 3300042602 Ga0466713_049079 Ga0466713_049079_2520_3200 226
36 3300042606 Ga0466719_025880 Ga0466719_025880_1640_2320 226
37 3300042606 Ga0466719_368693 Ga0466719_368693_3564_4244 226
38 3300042609 Ga0466722_094026 Ga0466722_094026_3943_4623 226
39 3300042609 Ga0466722_143944 Ga0466722_143944_10535_11215 226
40 3300042616 Ga0466715_119466 Ga0466715_119466_2951_3631 226
41 3300042616 Ga0466715_187702 Ga0466715_187702_1837_2517 226
42 3300042616 Ga0466715_274255 Ga0466715_274255_5157_5837 226
43 3300042620 Ga0466728_432805 Ga0466728_432805_622_1302 226
44 3300042624 Ga0466735_016838 Ga0466735_016838_24661_25341 226
45 3300042624 Ga0466735_056602 Ga0466735_056602_319_999 226
46 3300042624 Ga0466735_090008 Ga0466735_090008_2419_3099 226
47 3300042636 Ga0466703_030205 Ga0466703_030205_3724_4404 226
48 3300042636 Ga0466703_033925 Ga0466703_033925_710_1390 226
49 3300042636 Ga0466703_048088 Ga0466703_048088_7121_7801 226
50 3300042636 Ga0466703_067681 Ga0466703_067681_4720_5400 226
51 3300042652 Ga0466708_080881 Ga0466708_080881_2999_3679 226
52 iso_pr_bacteria 2967483437 2967486092 226
53 3300009784 Ga0123357_10015250 Ga0123357_100152509 227
54 3300042598 Ga0466701_053913 Ga0466701_053913_3068_3751 227
55 3300042616 Ga0466715_546483 Ga0466715_546483_11668_12351 227
56 3300042619 Ga0466726_005269 Ga0466726_005269_226_909 227
57 3300042623 Ga0466734_082022 Ga0466734_082022_59_742 227
58 3300042655 Ga0466727_169478 Ga0466727_169478_1724_2407 227
59 iso_pr_bacteria 3004667792 3004671297 227
60 3300002462 JGI24702J35022_10208905 JGI24702J35022_102089051 228
61 3300009784 Ga0123357_10401724 Ga0123357_104017242 228
62 3300010882 Ga0123354_10007441 Ga0123354_1000744114 228
63 3300042593 Ga0466691_006494 Ga0466691_006494_9649_10335 228
64 3300042600 Ga0466700_115552 Ga0466700_115552_12357_13043 228
65 3300042601 Ga0466707_018219 Ga0466707_018219_4970_5656 228
66 3300042601 Ga0466707_106749 Ga0466707_106749_15433_16119 228
67 3300042606 Ga0466719_302108 Ga0466719_302108_1672_2358 228
68 3300042606 Ga0466719_434400 Ga0466719_434400_67_753 228
69 3300042615 Ga0466711_236413 Ga0466711_236413_2344_3030 228
70 3300042615 Ga0466711_463674 Ga0466711_463674_471_1157 228
71 3300042618 Ga0466723_153364 Ga0466723_153364_2142_2828 228
72 3300042624 Ga0466735_085612 Ga0466735_085612_454_1140 228
73 iso_pr_bacteria 2695420317 2695485923 228
74 iso_pr_bacteria 2873600114 2873601985 228
75 iso_pr_bacteria 2873610414 2873612349 228
76 iso_pr_bacteria 8100157865 8100158814 228
77 2225789004 2227467416 2227908362 229
78 3300042590 Ga0466690_017517 Ga0466690_017517_8118_8807 229
79 3300042591 Ga0466692_202977 Ga0466692_202977_24890_25579 229
80 3300042600 Ga0466700_093178 Ga0466700_093178_1494_2183 229
81 3300042600 Ga0466700_491849 Ga0466700_491849_518_1207 229
82 3300042601 Ga0466707_018443 Ga0466707_018443_3395_4084 229
83 3300042602 Ga0466713_033020 Ga0466713_033020_1506_2195 229
84 3300042606 Ga0466719_515918 Ga0466719_515918_3545_4234 229
85 3300042609 Ga0466722_148628 Ga0466722_148628_10186_10875 229
86 3300042609 Ga0466722_252821 Ga0466722_252821_43996_44685 229
87 3300042617 Ga0466718_152551 Ga0466718_152551_84_773 229
88 3300042620 Ga0466728_338284 Ga0466728_338284_76755_77444 229
89 3300042652 Ga0466708_246412 Ga0466708_246412_4797_5486 229
90 iso_pr_bacteria 2910949487 2910951629 229
91 3300000062 IMNBL1DRAFT_c0000013 IMNBL1DRAFT_000001379 230
92 3300005083 Ga0068305_10171143 Ga0068305_101711433 230
93 3300005083 Ga0068305_10460416 Ga0068305_104604162 230
94 3300042593 Ga0466691_111298 Ga0466691_111298_3819_4511 230
95 3300042602 Ga0466713_146312 Ga0466713_146312_305_997 230
96 3300042615 Ga0466711_086368 Ga0466711_086368_5040_5732 230
97 3300042621 Ga0466729_281255 Ga0466729_281255_1338_2030 230
98 3300042623 Ga0466734_159763 Ga0466734_159763_711_1403 230
99 3300042643 Ga0466704_192038 Ga0466704_192038_2270_2962 230
100 3300042655 Ga0466727_219343 Ga0466727_219343_460_1152 230
101 iso_pr_bacteria 2695420314 2695473122 230
102 iso_pr_bacteria 2940216256 2940217415 230
103 2225789004 2227474342 2227924185 231
104 3300002462 JGI24702J35022_10010884 JGI24702J35022_100108844 231
105 3300002509 JGI24699J35502_11133869 JGI24699J35502_111338698 231
106 3300002834 JGI24696J40584_12960435 JGI24696J40584_129604352 231
107 3300010049 Ga0123356_10880786 Ga0123356_108807862 231
108 3300042590 Ga0466690_119681 Ga0466690_119681_13754_14449 231
109 3300042601 Ga0466707_395101 Ga0466707_395101_818_1513 231
110 3300042605 Ga0466716_020808 Ga0466716_020808_432_1127 231
111 3300042605 Ga0466716_197148 Ga0466716_197148_2267_2962 231
112 3300042605 Ga0466716_241806 Ga0466716_241806_1772_2467 231
113 3300042615 Ga0466711_176561 Ga0466711_176561_479_1174 231
114 3300042620 Ga0466728_267319 Ga0466728_267319_12111_12806 231
115 3300042620 Ga0466728_324686 Ga0466728_324686_750_1445 231
116 3300000062 IMNBL1DRAFT_c0001604 IMNBL1DRAFT_000160411 232
117 3300000062 IMNBL1DRAFT_c0006815 IMNBL1DRAFT_00068154 232
118 3300009784 Ga0123357_10006248 Ga0123357_100062489 232
119 3300009784 Ga0123357_10037229 Ga0123357_100372294 232
120 3300009784 Ga0123357_10241058 Ga0123357_102410582 232
121 3300010882 Ga0123354_10131301 Ga0123354_101313012 232
122 3300042592 Ga0466693_041412 Ga0466693_041412_906_1604 232
123 3300042592 Ga0466693_421468 Ga0466693_421468_1963_2661 232
124 3300042596 Ga0466696_333016 Ga0466696_333016_1810_2508 232
125 3300042599 Ga0466706_260080 Ga0466706_260080_167_865 232
126 3300042601 Ga0466707_254503 Ga0466707_254503_2282_2980 232
127 3300042606 Ga0466719_161072 Ga0466719_161072_1359_2057 232
128 3300042615 Ga0466711_222138 Ga0466711_222138_31138_31836 232
129 3300042620 Ga0466728_398353 Ga0466728_398353_1024_1722 232
130 3300042624 Ga0466735_229986 Ga0466735_229986_1402_2100 232
131 3300042624 Ga0466735_232566 Ga0466735_232566_628_1326 232
132 3300042654 Ga0466725_317005 Ga0466725_317005_14940_15638 232
133 3300042655 Ga0466727_270580 Ga0466727_270580_1077_1775 232
134 3300056842 Ga0562377_0004 Ga0562377_0004_3405015_3405713 232
135 iso_pr_bacteria 2940193328 2940194566 232
136 iso_pr_bacteria 2940336608 2940337842 232
137 2225789004 2227560735 2228097377 233
138 3300010882 Ga0123354_10052158 Ga0123354_100521586 233
139 3300042599 Ga0466706_203102 Ga0466706_203102_11321_12022 233
140 3300042602 Ga0466713_058280 Ga0466713_058280_8442_9143 233
141 3300042612 Ga0466705_491715 Ga0466705_491715_6469_7170 233
142 3300042616 Ga0466715_127650 Ga0466715_127650_2881_3582 233
143 3300042620 Ga0466728_246698 Ga0466728_246698_442_1143 233
144 3300042621 Ga0466729_205396 Ga0466729_205396_2630_3331 233
145 3300042643 Ga0466704_170080 Ga0466704_170080_28155_28856 233
146 3300042654 Ga0466725_160865 Ga0466725_160865_3172_3873 233
147 3300042659 Ga0466733_049019 Ga0466733_049019_4470_5171 233
148 iso_pr_bacteria 2820762746 2820763940 233
149 iso_pr_bacteria 2922326829 2922327700 233
150 3300002504 JGI24705J35276_12200381 JGI24705J35276_122003812 234
151 3300002509 JGI24699J35502_11134064 JGI24699J35502_1113406410 234
152 3300010882 Ga0123354_10002273 Ga0123354_1000227326 234
153 3300010882 Ga0123354_10006992 Ga0123354_1000699213 234
154 3300042591 Ga0466692_147406 Ga0466692_147406_4614_5318 234
155 3300042601 Ga0466707_056811 Ga0466707_056811_2916_3620 234
156 3300042636 Ga0466703_005407 Ga0466703_005407_3996_4700 234
157 3300042590 Ga0466690_296510 Ga0466690_296510_12470_13177 235
158 3300042593 Ga0466691_181414 Ga0466691_181414_2098_2805 235
159 3300042601 Ga0466707_200784 Ga0466707_200784_35_742 235
160 3300042612 Ga0466705_016778 Ga0466705_016778_3205_3912 235
161 3300042612 Ga0466705_342178 Ga0466705_342178_20988_21695 235
162 3300042616 Ga0466715_006491 Ga0466715_006491_1574_2281 235
163 3300042620 Ga0466728_109323 Ga0466728_109323_27666_28373 235
164 3300042620 Ga0466728_128512 Ga0466728_128512_20556_21263 235
165 3300042624 Ga0466735_107145 Ga0466735_107145_6285_6992 235
166 3300042636 Ga0466703_320358 Ga0466703_320358_27274_27981 235
167 3300042643 Ga0466704_023620 Ga0466704_023620_1339_2046 235
168 3300042643 Ga0466704_096675 Ga0466704_096675_3801_4508 235
169 3300042643 Ga0466704_259836 Ga0466704_259836_2290_2997 235
170 3300042643 Ga0466704_342826 Ga0466704_342826_4972_5679 235
171 3300042648 Ga0466709_052166 Ga0466709_052166_21877_22584 235
172 iso_pr_bacteria 2820759988 2820762343 235
173 iso_pr_bacteria 2940195863 2940196410 235
174 2225789003 2227072440 2227435166 236
175 3300002509 JGI24699J35502_11134209 JGI24699J35502_1113420911 236
176 3300042590 Ga0466690_169035 Ga0466690_169035_6296_7006 236
177 3300042605 Ga0466716_054306 Ga0466716_054306_2676_3386 236
178 3300042612 Ga0466705_320045 Ga0466705_320045_1164_1874 236
179 3300042616 Ga0466715_172001 Ga0466715_172001_5635_6345 236
180 3300042636 Ga0466703_156231 Ga0466703_156231_3953_4663 236
181 3300042636 Ga0466703_223832 Ga0466703_223832_3507_4217 236
182 3300042636 Ga0466703_396203 Ga0466703_396203_1106_1816 236
183 3300042643 Ga0466704_458103 Ga0466704_458103_131_841 236
184 3300042643 Ga0466704_540065 Ga0466704_540065_6475_7185 236
185 3300042652 Ga0466708_031780 Ga0466708_031780_9777_10487 236
186 3300042652 Ga0466708_233940 Ga0466708_233940_6925_7635 236
187 3300042590 Ga0466690_083768 Ga0466690_083768_16970_17683 237
188 3300042590 Ga0466690_146535 Ga0466690_146535_4494_5207 237
189 3300042591 Ga0466692_157590 Ga0466692_157590_5400_6113 237
190 3300042621 Ga0466729_135755 Ga0466729_135755_5757_6470 237
191 3300042643 Ga0466704_136900 Ga0466704_136900_5958_6671 237
192 3300002504 JGI24705J35276_12092546 JGI24705J35276_120925462 238
193 3300042619 Ga0466726_442562 Ga0466726_442562_15899_16615 238
194 3300042624 Ga0466735_214834 Ga0466735_214834_2080_2796 238
195 3300010882 Ga0123354_10020461 Ga0123354_100204619 239
196 3300042612 Ga0466705_005625 Ga0466705_005625_9357_10076 239
197 3300042597 Ga0466699_147168 Ga0466699_147168_4242_4964 240
198 3300042598 Ga0466701_015645 Ga0466701_015645_3468_4193 241
199 3300042602 Ga0466713_068672 Ga0466713_068672_41155_41880 241
200 3300042643 Ga0466704_037901 Ga0466704_037901_7771_8496 241
201 3300042611 Ga0466697_007298 Ga0466697_007298_681_1418 245
202 3300042659 Ga0466733_110309 Ga0466733_110309_1788_2525 245
203 3300002462 JGI24702J35022_10026334 JGI24702J35022_100263341 246
204 3300010882 Ga0123354_10006263 Ga0123354_100062638 248
205 3300042591 Ga0466692_086870 Ga0466692_086870_1661_2407 248
206 3300042655 Ga0466727_116386 Ga0466727_116386_5810_6568 252
207 3300042601 Ga0466707_271224 Ga0466707_271224_5690_6460 256
208 3300042624 Ga0466735_153690 Ga0466735_153690_90_878 262
209 3300042594 Ga0466694_199834 Ga0466694_199834_755_1555 266

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain) 35 181 0.96
PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain 182 220 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01509 GO:0006396 RNA processing BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.