Protein Family IF09457

Metagenome Isolate
159 Members
58 Samples
145 Scaffolds
226.69 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_293750|Ga0466704_293750_137_925
Length
262 aa
Sequence
MRCVLAGIMVWHGFGTYNGINNRAPLLRAPEKIENIMIKIENLKKVFRTEEVETVALNEVSLEVNRSEFIAVMGPSGCGKSTLLNILGLLDNPTAGTYHLAEQEVGHLKEKDRTQARKGNIGFVFQSFNLIEEMSVFENVELPLVYMKVGKAERRLRVDEALKRMSISHRAKHFPNQLSGGQQQRVAIARAVVSNPKIILADEPTGNLDSKNGRDVMDLLSELNREGTTIVMVTHSQHDASFAHRIINLFDGQIVTEVQSRM

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.2%
Kalotermitidae 22.4%
Blattidae 12.1%
Unclassified 8.6%
Rhinotermitidae 6.9%
Termopsidae 5.2%
Passalidae 3.4%
Hydrophilidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
4 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
13 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
14 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
15 3004677695 Bacteroides sp. 214 Isolate Blattidae
16 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
17 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
36 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
37 3004672520 Bacteroides sp. 51 Isolate Blattidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
41 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
48 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
49 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
50 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_152205 3300042612 Bacteria 1037
2 Ga0466733_211697 3300042659 Bacteria 5503
3 Ga0123354_10010911 3300010882 Bacteria 14018
4 Ga0466704_293750 3300042643 Bacteria 1288
5 Ga0466709_136530 3300042648 Bacteria 9010
6 Ga0466709_176022 3300042648 Unclassified 5584
7 Ga0466725_358148 3300042654 Bacteria 1186
8 Ga0466707_324535 3300042601 Bacteria 1038
9 Ga0466714_132007 3300042603 Bacteria 2273
10 Ga0466714_158324 3300042603 Bacteria 1134
11 Ga0466715_162401 3300042616 Bacteria 1324
12 JGI24705J35276_12233267 3300002504 Bacteria 4753
13 Ga0466705_205326 3300042612 Bacteria 5933
14 Ga0466705_228204 3300042612 Bacteria 8413
15 Ga0466694_134428 3300042594 Bacteria 1005
16 Ga0466694_359347 3300042594 Bacteria 2004
17 Ga0123357_10061808 3300009784 Unclassified 5018
18 Ga0123357_10103289 3300009784 Bacteria 3666
19 Ga0123356_10590674 3300010049 Bacteria 1274
20 Ga0123354_10093302 3300010882 Bacteria 4139
21 Ga0466729_266211 3300042621 Unclassified 2964
22 Ga0466707_175751 3300042601 Bacteria 1991
23 Ga0466713_136308 3300042602 Bacteria 60881
24 Ga0466714_026670 3300042603 Unclassified 15441
25 Ga0466714_083935 3300042603 Unclassified 9653
26 Ga0466714_147952 3300042603 Bacteria 5594
27 Ga0466716_320508 3300042605 Bacteria 7064
28 Ga0466710_203831 3300042613 Bacteria 1643
29 Ga0466711_294920 3300042615 Bacteria 4911
30 JGI24705J35276_12047795 3300002504 Unclassified 913
31 JGI24699J35502_10967692 3300002509 Bacteria 1225
32 JGI24699J35502_11133772 3300002509 Bacteria 15223
33 Ga0466690_206376 3300042590 Bacteria 31826
34 Ga0466690_385612 3300042590 Bacteria 8468
35 Ga0466693_249152 3300042592 Bacteria 1080
36 Ga0466694_166494 3300042594 Bacteria 3875
37 Ga0466701_006557 3300042598 Bacteria 5726
38 Ga0123356_10616457 3300010049 Bacteria 1250
39 Ga0123353_10094917 3300010167 Unclassified 4805
40 Ga0123354_10086928 3300010882 Unclassified 4366
41 Ga0466735_009089 3300042624 Bacteria 8225
42 Ga0466703_047686 3300042636 Bacteria 11689
43 Ga0466704_062392 3300042643 Bacteria 22291
44 Ga0466701_016636 3300042598 Bacteria 1501
45 Ga0466714_068028 3300042603 Unclassified 2218
46 Ga0466714_097034 3300042603 Bacteria 3543
47 Ga0466714_150527 3300042603 Bacteria 4002
48 Ga0466716_437183 3300042605 Bacteria 31064
49 IMNBL1DRAFT_c0011546 3300000062 Bacteria 4117
50 Ga0466697_199531 3300042611 Bacteria 1507
51 Ga0466733_167796 3300042659 Bacteria 7257
52 Ga0466692_193704 3300042591 Bacteria 3450
53 Ga0466693_326124 3300042592 Bacteria 4006
54 Ga0123357_10009380 3300009784 Bacteria 12353
55 Ga0123356_10017159 3300010049 Bacteria 6890
56 Ga0466734_145094 3300042623 Bacteria 1366
57 Ga0466735_074129 3300042624 Bacteria 1151
58 Ga0466735_189042 3300042624 Bacteria 4105
59 Ga0466703_243185 3300042636 Bacteria 1717
60 Ga0466727_017548 3300042655 Bacteria 9569
61 Ga0466701_075588 3300042598 Unclassified 4922
62 Ga0466707_412331 3300042601 Unclassified 7486
63 Ga0466713_091714 3300042602 Bacteria 189911
64 Ga0466714_052845 3300042603 Bacteria 5510
65 Ga0466714_069805 3300042603 Bacteria 22687
66 Ga0466714_132509 3300042603 Bacteria 2651
67 Ga0466715_096433 3300042616 Bacteria 41816
68 Ga0466723_141338 3300042618 Bacteria 4626
69 Ga0466723_251209 3300042618 Bacteria 2472
70 JGI24696J40584_12862979 3300002834 Bacteria 1018
71 Ga0466705_019993 3300042612 Bacteria 19075
72 Ga0466705_158704 3300042612 Bacteria 10601
73 Ga0466705_314443 3300042612 Unclassified 4279
74 Ga0466733_115294 3300042659 Bacteria 114356
75 Ga0466657_315697 3300042582 Bacteria 1022
76 Ga0123356_10927894 3300010049 Bacteria 1042
77 Ga0466701_039358 3300042598 Bacteria 2951
78 Ga0466706_263700 3300042599 Bacteria 15446
79 Ga0466714_007361 3300042603 Unclassified 6184
80 Ga0466714_025607 3300042603 Bacteria 4774
81 Ga0466714_108048 3300042603 Unclassified 1828
82 Ga0466719_063766 3300042606 Bacteria 5343
83 Ga0466712_110256 3300042614 Bacteria 1157
84 Ga0466715_245779 3300042616 Bacteria 9354
85 Ga0466726_196707 3300042619 Unclassified 3838
86 2227563519 2225789004 Bacteria 14404
87 JGI24699J35502_11005196 3300002509 Bacteria 1372
88 Ga0466691_067133 3300042593 Bacteria 4212
89 Ga0466696_207440 3300042596 Bacteria 1732
90 Ga0123357_10063051 3300009784 Bacteria 4958
91 Ga0123353_10011026 3300010167 Bacteria 12690
92 Ga0123354_10338399 3300010882 Bacteria 1360
93 Ga0466703_180370 3300042636 Bacteria 2986
94 Ga0466709_219154 3300042648 Bacteria 176728
95 Ga0466700_074861 3300042600 Unclassified 4834
96 Ga0466707_273341 3300042601 Bacteria 1110
97 Ga0466714_081893 3300042603 Bacteria 9910
98 Ga0466719_133309 3300042606 Bacteria 5824
99 Ga0466728_158036 3300042620 Bacteria 2503
100 Ga0466729_073949 3300042621 Bacteria 13137
101 JGI24702J35022_10269292 3300002462 Bacteria 996
102 Ga0466697_269670 3300042611 Bacteria 2782
103 Ga0466733_011388 3300042659 Bacteria 6499
104 Ga0466694_377022 3300042594 Bacteria 1103
105 Ga0466696_050605 3300042596 Bacteria 8934
106 Ga0466729_216498 3300042621 Unclassified 2993
107 Ga0466729_263652 3300042621 Bacteria 15570
108 Ga0466735_192481 3300042624 Unclassified 2544
109 Ga0466704_568888 3300042643 Bacteria 3152
110 Ga0466709_285715 3300042648 Bacteria 24593
111 Ga0466727_089068 3300042655 Bacteria 9947
112 Ga0466706_280232 3300042599 Bacteria 1303
113 Ga0466700_358694 3300042600 Bacteria 9134
114 Ga0466707_302696 3300042601 Bacteria 10116
115 Ga0466719_120115 3300042606 Bacteria 6686
116 Ga0466710_112995 3300042613 Bacteria 1607
117 Ga0466726_072057 3300042619 Bacteria 16625
118 Ga0466729_082905 3300042621 Bacteria 5844
119 IMNBL1DRAFT_c0002265 3300000062 Bacteria 13543
120 Ga0466705_039414 3300042612 Unclassified 1730
121 Ga0466733_141982 3300042659 Unclassified 1472
122 Ga0466733_175131 3300042659 Bacteria 24781
123 Ga0466690_128755 3300042590 Bacteria 5908
124 Ga0466690_138026 3300042590 Bacteria 33660
125 Ga0466692_166395 3300042591 Bacteria 3685
126 Ga0466694_142711 3300042594 Bacteria 1066
127 Ga0466696_013622 3300042596 Bacteria 5850
128 Ga0466696_220752 3300042596 Bacteria 21180
129 Ga0123357_10106891 3300009784 Bacteria 3585
130 Ga0123356_10295505 3300010049 Bacteria 1722
131 Ga0123354_10435941 3300010882 Unclassified 1075
132 Ga0123354_10456567 3300010882 Unclassified 1030
133 Ga0466703_381185 3300042636 Bacteria 1206
134 Ga0466704_583464 3300042643 Bacteria 34188
135 Ga0466727_153541 3300042655 Unclassified 9458
136 Ga0466707_008477 3300042601 Bacteria 11214
137 Ga0466707_393526 3300042601 Bacteria 7714
138 Ga0466714_012557 3300042603 Bacteria 1614
139 Ga0466714_038452 3300042603 Unclassified 1187
140 Ga0466710_186551 3300042613 Bacteria 4586
141 Ga0466715_425730 3300042616 Bacteria 12959
142 Ga0466718_089107 3300042617 Bacteria 1200
143 IMNBL1DRAFT_c0024389 3300000062 Bacteria 2346
144 JGI24702J35022_10035011 3300002462 Bacteria 2686
145 JGI24702J35022_10051268 3300002462 Bacteria 2199

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042603 Ga0466714_025607 Ga0466714_025607_225_908 212
2 3300042594 Ga0466694_134428 Ga0466694_134428_179_847 222
3 3300042616 Ga0466715_425730 Ga0466715_425730_9052_9720 222
4 3300042594 Ga0466694_142711 Ga0466694_142711_340_1011 223
5 3300010049 Ga0123356_10295505 Ga0123356_102955052 224
6 3300010882 Ga0123354_10338399 Ga0123354_103383991 224
7 3300042592 Ga0466693_249152 Ga0466693_249152_245_919 224
8 3300042596 Ga0466696_013622 Ga0466696_013622_153_827 224
9 3300042596 Ga0466696_050605 Ga0466696_050605_1888_2562 224
10 3300042605 Ga0466716_320508 Ga0466716_320508_1328_2002 224
11 3300042611 Ga0466697_269670 Ga0466697_269670_307_981 224
12 3300042616 Ga0466715_096433 Ga0466715_096433_30909_31583 224
13 3300042621 Ga0466729_263652 Ga0466729_263652_11022_11696 224
14 iso_pr_bacteria 3004672520 3004676475 224
15 3300042611 Ga0466697_199531 Ga0466697_199531_762_1439 225
16 iso_pr_bacteria 3004677695 3004679396 225
17 3300042590 Ga0466690_128755 Ga0466690_128755_2027_2707 226
18 3300042590 Ga0466690_138026 Ga0466690_138026_20368_21048 226
19 3300042590 Ga0466690_385612 Ga0466690_385612_2774_3454 226
20 3300042591 Ga0466692_166395 Ga0466692_166395_360_1040 226
21 3300042591 Ga0466692_193704 Ga0466692_193704_2219_2899 226
22 3300042592 Ga0466693_326124 Ga0466693_326124_863_1543 226
23 3300042593 Ga0466691_067133 Ga0466691_067133_3091_3771 226
24 3300042594 Ga0466694_166494 Ga0466694_166494_1772_2452 226
25 3300042594 Ga0466694_359347 Ga0466694_359347_340_1020 226
26 3300042594 Ga0466694_377022 Ga0466694_377022_406_1086 226
27 3300042596 Ga0466696_207440 Ga0466696_207440_213_893 226
28 3300042596 Ga0466696_220752 Ga0466696_220752_523_1203 226
29 3300042598 Ga0466701_006557 Ga0466701_006557_4622_5302 226
30 3300042598 Ga0466701_016636 Ga0466701_016636_684_1364 226
31 3300042598 Ga0466701_039358 Ga0466701_039358_293_973 226
32 3300042598 Ga0466701_075588 Ga0466701_075588_1527_2207 226
33 3300042599 Ga0466706_263700 Ga0466706_263700_8850_9530 226
34 3300042599 Ga0466706_280232 Ga0466706_280232_199_879 226
35 3300042600 Ga0466700_074861 Ga0466700_074861_2726_3406 226
36 3300042600 Ga0466700_358694 Ga0466700_358694_6094_6774 226
37 3300042601 Ga0466707_008477 Ga0466707_008477_7667_8347 226
38 3300042601 Ga0466707_175751 Ga0466707_175751_844_1524 226
39 3300042601 Ga0466707_273341 Ga0466707_273341_291_971 226
40 3300042601 Ga0466707_302696 Ga0466707_302696_5240_5920 226
41 3300042601 Ga0466707_324535 Ga0466707_324535_83_763 226
42 3300042601 Ga0466707_393526 Ga0466707_393526_6385_7065 226
43 3300042601 Ga0466707_412331 Ga0466707_412331_5006_5686 226
44 3300042602 Ga0466713_091714 Ga0466713_091714_27439_28119 226
45 3300042602 Ga0466713_136308 Ga0466713_136308_28454_29134 226
46 3300042603 Ga0466714_007361 Ga0466714_007361_5087_5767 226
47 3300042603 Ga0466714_012557 Ga0466714_012557_163_843 226
48 3300042603 Ga0466714_026670 Ga0466714_026670_6891_7571 226
49 3300042603 Ga0466714_038452 Ga0466714_038452_172_852 226
50 3300042603 Ga0466714_052845 Ga0466714_052845_2402_3082 226
51 3300042603 Ga0466714_068028 Ga0466714_068028_192_872 226
52 3300042603 Ga0466714_069805 Ga0466714_069805_13663_14343 226
53 3300042603 Ga0466714_097034 Ga0466714_097034_686_1366 226
54 3300042603 Ga0466714_132007 Ga0466714_132007_168_848 226
55 3300042603 Ga0466714_132509 Ga0466714_132509_194_874 226
56 3300042603 Ga0466714_147952 Ga0466714_147952_3278_3958 226
57 3300042603 Ga0466714_150527 Ga0466714_150527_1995_2675 226
58 3300042603 Ga0466714_158324 Ga0466714_158324_157_837 226
59 3300042605 Ga0466716_437183 Ga0466716_437183_10279_10959 226
60 3300042606 Ga0466719_063766 Ga0466719_063766_3809_4489 226
61 3300042606 Ga0466719_120115 Ga0466719_120115_4463_5143 226
62 3300042606 Ga0466719_133309 Ga0466719_133309_4600_5280 226
63 3300042612 Ga0466705_019993 Ga0466705_019993_2706_3386 226
64 3300042612 Ga0466705_039414 Ga0466705_039414_799_1479 226
65 3300042612 Ga0466705_158704 Ga0466705_158704_8175_8855 226
66 3300042612 Ga0466705_228204 Ga0466705_228204_381_1061 226
67 3300042612 Ga0466705_314443 Ga0466705_314443_1048_1728 226
68 3300042613 Ga0466710_186551 Ga0466710_186551_2778_3458 226
69 3300042613 Ga0466710_203831 Ga0466710_203831_840_1520 226
70 3300042614 Ga0466712_110256 Ga0466712_110256_284_964 226
71 3300042615 Ga0466711_294920 Ga0466711_294920_1555_2235 226
72 3300042616 Ga0466715_162401 Ga0466715_162401_130_810 226
73 3300042616 Ga0466715_245779 Ga0466715_245779_2389_3069 226
74 3300042617 Ga0466718_089107 Ga0466718_089107_129_809 226
75 3300042618 Ga0466723_141338 Ga0466723_141338_3565_4245 226
76 3300042619 Ga0466726_072057 Ga0466726_072057_15427_16107 226
77 3300042619 Ga0466726_196707 Ga0466726_196707_1886_2566 226
78 3300042621 Ga0466729_073949 Ga0466729_073949_12078_12758 226
79 3300042621 Ga0466729_082905 Ga0466729_082905_62_742 226
80 3300042621 Ga0466729_216498 Ga0466729_216498_242_922 226
81 3300042621 Ga0466729_266211 Ga0466729_266211_2212_2892 226
82 3300042623 Ga0466734_145094 Ga0466734_145094_656_1336 226
83 3300042624 Ga0466735_009089 Ga0466735_009089_2689_3369 226
84 3300042624 Ga0466735_074129 Ga0466735_074129_39_719 226
85 3300042624 Ga0466735_189042 Ga0466735_189042_170_850 226
86 3300042624 Ga0466735_192481 Ga0466735_192481_238_918 226
87 3300042636 Ga0466703_047686 Ga0466703_047686_9717_10397 226
88 3300042636 Ga0466703_180370 Ga0466703_180370_651_1331 226
89 3300042636 Ga0466703_243185 Ga0466703_243185_378_1058 226
90 3300042636 Ga0466703_381185 Ga0466703_381185_419_1099 226
91 3300042643 Ga0466704_062392 Ga0466704_062392_3080_3760 226
92 3300042643 Ga0466704_568888 Ga0466704_568888_383_1063 226
93 3300042643 Ga0466704_583464 Ga0466704_583464_18768_19448 226
94 3300042648 Ga0466709_136530 Ga0466709_136530_5483_6163 226
95 3300042648 Ga0466709_176022 Ga0466709_176022_3513_4193 226
96 3300042648 Ga0466709_219154 Ga0466709_219154_50180_50860 226
97 3300042648 Ga0466709_285715 Ga0466709_285715_21873_22553 226
98 3300042654 Ga0466725_358148 Ga0466725_358148_194_874 226
99 3300042655 Ga0466727_017548 Ga0466727_017548_8216_8896 226
100 3300042655 Ga0466727_089068 Ga0466727_089068_5284_5964 226
101 3300042655 Ga0466727_153541 Ga0466727_153541_5334_6014 226
102 3300042659 Ga0466733_011388 Ga0466733_011388_1395_2075 226
103 3300042659 Ga0466733_115294 Ga0466733_115294_9461_10141 226
104 3300042659 Ga0466733_141982 Ga0466733_141982_658_1338 226
105 3300042659 Ga0466733_167796 Ga0466733_167796_4890_5570 226
106 3300042659 Ga0466733_175131 Ga0466733_175131_8006_8686 226
107 3300042659 Ga0466733_211697 Ga0466733_211697_2641_3321 226
108 iso_pr_bacteria 2695420317 2695484437 226
109 iso_pr_bacteria 2820757377 2820757834 226
110 iso_pr_bacteria 2820772500 2820773893 226
111 iso_pr_bacteria 2873600114 2873601871 226
112 iso_pr_bacteria 2873610414 2873612194 226
113 iso_pr_bacteria 2910942425 2910946105 226
114 iso_pr_bacteria 2940244548 2940247010 226
115 iso_pr_bacteria 2940248789 2940250972 226
116 iso_pr_bacteria 2940253009 2940255122 226
117 iso_pr_bacteria 2940257232 2940259119 226
118 iso_pr_bacteria 8100157865 8100158973 226
119 iso_pr_bacteria 8100166142 8100170003 226
120 3300000062 IMNBL1DRAFT_c0002265 IMNBL1DRAFT_000226512 227
121 3300000062 IMNBL1DRAFT_c0011546 IMNBL1DRAFT_00115463 227
122 3300000062 IMNBL1DRAFT_c0024389 IMNBL1DRAFT_00243892 227
123 3300002462 JGI24702J35022_10035011 JGI24702J35022_100350112 227
124 3300002462 JGI24702J35022_10051268 JGI24702J35022_100512681 227
125 3300002462 JGI24702J35022_10269292 JGI24702J35022_102692922 227
126 3300002504 JGI24705J35276_12047795 JGI24705J35276_120477951 227
127 3300002504 JGI24705J35276_12233267 JGI24705J35276_122332675 227
128 3300002509 JGI24699J35502_10967692 JGI24699J35502_109676921 227
129 3300002509 JGI24699J35502_11005196 JGI24699J35502_110051961 227
130 3300002509 JGI24699J35502_11133772 JGI24699J35502_1113377211 227
131 3300009784 Ga0123357_10009380 Ga0123357_100093805 227
132 3300009784 Ga0123357_10061808 Ga0123357_100618083 227
133 3300009784 Ga0123357_10063051 Ga0123357_100630513 227
134 3300009784 Ga0123357_10103289 Ga0123357_101032893 227
135 3300009784 Ga0123357_10106891 Ga0123357_101068912 227
136 3300010049 Ga0123356_10590674 Ga0123356_105906742 227
137 3300010049 Ga0123356_10616457 Ga0123356_106164571 227
138 3300010049 Ga0123356_10927894 Ga0123356_109278941 227
139 3300010167 Ga0123353_10011026 Ga0123353_100110264 227
140 3300010882 Ga0123354_10010911 Ga0123354_1001091113 227
141 3300010882 Ga0123354_10086928 Ga0123354_100869283 227
142 3300010882 Ga0123354_10093302 Ga0123354_100933022 227
143 3300010882 Ga0123354_10435941 Ga0123354_104359411 227
144 3300010882 Ga0123354_10456567 Ga0123354_104565672 227
145 2225789004 2227563519 2228103288 228
146 3300042603 Ga0466714_083935 Ga0466714_083935_6908_7597 229
147 3300042603 Ga0466714_108048 Ga0466714_108048_317_1006 229
148 3300002834 JGI24696J40584_12862979 JGI24696J40584_128629792 230
149 3300010049 Ga0123356_10017159 Ga0123356_100171597 230
150 3300010167 Ga0123353_10094917 Ga0123353_100949175 230
151 3300042603 Ga0466714_081893 Ga0466714_081893_6400_7095 231
152 3300042582 Ga0466657_315697 Ga0466657_315697_145_846 233
153 3300042612 Ga0466705_152205 Ga0466705_152205_212_1000 233
154 3300042618 Ga0466723_251209 Ga0466723_251209_546_1250 234
155 3300042620 Ga0466728_158036 Ga0466728_158036_171_878 235
156 3300042613 Ga0466710_112995 Ga0466710_112995_726_1439 237
157 3300042590 Ga0466690_206376 Ga0466690_206376_26203_26919 238
158 3300042612 Ga0466705_205326 Ga0466705_205326_4488_5216 242
159 3300042643 Ga0466704_293750 Ga0466704_293750_137_925 262

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 57 205 0.96
PF03193 RsgA_GTPase RsgA GTPase 24 87 0.84
PF02463 SMC_N RecF/RecN/SMC N terminal domain 66 251 0.69

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.