Protein Family IF09456

Metagenome Isolate
214 Members
70 Samples
203 Scaffolds
144.99 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_293633|Ga0466704_293633_3459_3947
Length
162 aa
Sequence
LQINSFAQKQQNSLNINDLSSNLRSGRQRQFDCRYLEMARIWGKNSYCKRRQVGALLVKDRVIISDGYNGTPSGFENECEEDGVTKPYVLHAEANAITKVAKSNNSSEGATLYVTSSPCVECAKLIIQAGVKRVVFADHYHDVNGIGLLERAGIEVEQINID

📊 Sample Types

Isolate 5.1%
Metagenome 94.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.2%
Kalotermitidae 20.6%
Unclassified 11.8%
Blattidae 5.9%
Formicidae 5.9%
Rhinotermitidae 5.9%
Termopsidae 4.4%
Passalidae 2.9%
Hodotermitidae 1.5%
Elmidae 1.5%
Tenebrionidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 205
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
2 3004667792 Bacteroides sp. 519 Isolate Blattidae
3 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
4 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
12 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
25 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
39 2920168565 Paludibacter sp. 221 Isolate Blattidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
43 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
44 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
45 3004672520 Bacteroides sp. 51 Isolate Blattidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
53 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
54 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
58 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
65 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
66 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
67 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
68 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
69 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
70 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_232153 3300042612 Unclassified 17897
2 Ga0466733_140351 3300042659 Bacteria 7410
3 Ga0466733_170029 3300042659 Bacteria 24463
4 Ga0466696_306565 3300042596 Bacteria 2548
5 Ga0466696_454466 3300042596 Bacteria 2140
6 Ga0466731_157844 3300042622 Bacteria 1720
7 Ga0466735_168988 3300042624 Bacteria 1281
8 Ga0466703_082546 3300042636 Bacteria 11791
9 Ga0466704_077855 3300042643 Bacteria 18698
10 Ga0466704_293633 3300042643 Bacteria 4330
11 Ga0466709_012440 3300042648 Bacteria 7482
12 Ga0466709_156488 3300042648 Bacteria 77037
13 Ga0466724_46543 3300042649 Bacteria 311178
14 Ga0466706_001642 3300042599 Bacteria 38891
15 Ga0466706_012545 3300042599 Bacteria 1117
16 Ga0466700_036073 3300042600 Bacteria 2096
17 Ga0466707_012433 3300042601 Bacteria 1816
18 Ga0466707_111686 3300042601 Bacteria 2867
19 Ga0466713_100528 3300042602 Bacteria 510720
20 Ga0466714_137522 3300042603 Bacteria 1861
21 Ga0466722_215606 3300042609 Bacteria 1655
22 Ga0466722_240768 3300042609 Bacteria 19386
23 IMNBL1DRAFT_c0021349 3300000062 Bacteria 2593
24 JGI24702J35022_10009089 3300002462 Bacteria 5596
25 JGI24702J35022_10205364 3300002462 Bacteria 1129
26 Ga0072940_1122540 3300005200 Bacteria 2301
27 Ga0466697_247837 3300042611 Bacteria 1163
28 Ga0466705_335705 3300042612 Bacteria 4572
29 Ga0466705_376125 3300042612 Bacteria 32089
30 Ga0466705_384051 3300042612 Bacteria 8346
31 Ga0466732_086064 3300042656 Bacteria 15640
32 Ga0466733_088826 3300042659 Bacteria 19910
33 Ga0123356_10447442 3300010049 Bacteria 1439
34 Ga0123353_10754201 3300010167 Bacteria 1354
35 Ga0123353_11471528 3300010167 Bacteria 870
36 Ga0265387_1001491 3300024582 Bacteria 3433
37 Ga0466693_252782 3300042592 Bacteria 3565
38 Ga0466691_021365 3300042593 Bacteria 17759
39 Ga0466691_162389 3300042593 Unclassified 1425
40 Ga0466735_182589 3300042624 Bacteria 2603
41 Ga0466704_558196 3300042643 Bacteria 4661
42 Ga0466709_143793 3300042648 Bacteria 9535
43 Ga0466709_198981 3300042648 Unclassified 1128
44 Ga0466707_287159 3300042601 Bacteria 1061
45 Ga0466713_103922 3300042602 Bacteria 25414
46 Ga0466719_133938 3300042606 Bacteria 1675
47 Ga0466722_136407 3300042609 Bacteria 11020
48 Ga0466722_146807 3300042609 Bacteria 6613
49 Ga0466711_154251 3300042615 Bacteria 6424
50 Ga0466715_007714 3300042616 Bacteria 20281
51 Ga0466715_037900 3300042616 Bacteria 143938
52 Ga0466715_613585 3300042616 Bacteria 24795
53 Ga0466723_053207 3300042618 Bacteria 23381
54 Ga0466726_187244 3300042619 Bacteria 6679
55 Ga0072941_1113299 3300005201 Bacteria 2751
56 Ga0102735_1000448 3300007080 Bacteria 15147
57 Ga0102734_1000277 3300007129 Unclassified 15762
58 Ga0562377_0004 3300056842 Bacteria 3525959
59 Ga0466690_086237 3300042590 Bacteria 7872
60 Ga0466696_358309 3300042596 Bacteria 3090
61 Ga0466704_207509 3300042643 Bacteria 13537
62 Ga0466704_575698 3300042643 Unclassified 11655
63 Ga0466709_033872 3300042648 Bacteria 15123
64 Ga0466709_191028 3300042648 Bacteria 2026
65 Ga0466708_074679 3300042652 Bacteria 22411
66 Ga0466707_222304 3300042601 Bacteria 1240
67 Ga0466707_290896 3300042601 Bacteria 2843
68 Ga0466714_098947 3300042603 Bacteria 25874
69 Ga0466722_051355 3300042609 Bacteria 31148
70 Ga0466710_159728 3300042613 Bacteria 13105
71 Ga0466715_159345 3300042616 Bacteria 29954
72 Ga0466723_103648 3300042618 Bacteria 17894
73 Ga0466723_334830 3300042618 Bacteria 13949
74 2227489633 2225789004 Bacteria 798
75 IMNBL1DRAFT_c0003515 3300000062 Bacteria 10019
76 JGI24702J35022_10016701 3300002462 Bacteria 4020
77 JGI24702J35022_10147576 3300002462 Bacteria 1317
78 Ga0123356_10532773 3300010049 Bacteria 1334
79 Ga0466690_325412 3300042590 Bacteria 27630
80 Ga0466693_371460 3300042592 Bacteria 1988
81 Ga0466691_077664 3300042593 Bacteria 11257
82 Ga0466691_181397 3300042593 Bacteria 8411
83 Ga0466696_159350 3300042596 Bacteria 1828
84 Ga0466735_063754 3300042624 Bacteria 2319
85 Ga0466735_078782 3300042624 Bacteria 1166
86 Ga0466735_198945 3300042624 Bacteria 1051
87 Ga0466704_374004 3300042643 Bacteria 15901
88 Ga0466708_237408 3300042652 Bacteria 44666
89 Ga0466708_360582 3300042652 Bacteria 19909
90 Ga0466727_075634 3300042655 Bacteria 9423
91 Ga0466727_225961 3300042655 Bacteria 24553
92 Ga0466706_054670 3300042599 Bacteria 52813
93 Ga0466719_151669 3300042606 Bacteria 4151
94 Ga0466719_323961 3300042606 Bacteria 7308
95 Ga0466721_075675 3300042608 Bacteria 20229
96 Ga0466722_005794 3300042609 Bacteria 2981
97 Ga0466722_059494 3300042609 Bacteria 7148
98 Ga0466715_281564 3300042616 Bacteria 45897
99 Ga0466728_079520 3300042620 Bacteria 32961
100 IMNBL1DRAFT_c0016964 3300000062 Bacteria 3089
101 JGI24702J35022_10022691 3300002462 Bacteria 3394
102 Ga0123353_10005186 3300010167 Bacteria 17027
103 Ga0123353_10009487 3300010167 Bacteria 13445
104 Ga0466692_077218 3300042591 Bacteria 1887
105 Ga0466692_091832 3300042591 Bacteria 55079
106 Ga0466691_025023 3300042593 Bacteria 10683
107 Ga0466730_103185 3300042625 Bacteria 215676
108 Ga0466703_241786 3300042636 Bacteria 1950
109 Ga0466703_307651 3300042636 Bacteria 9241
110 Ga0466704_082193 3300042643 Bacteria 8478
111 Ga0466704_098066 3300042643 Bacteria 18725
112 Ga0466704_287710 3300042643 Bacteria 14291
113 Ga0466704_558352 3300042643 Unclassified 1531
114 Ga0466725_443278 3300042654 Bacteria 1288
115 Ga0466706_039310 3300042599 Bacteria 25656
116 Ga0466713_009775 3300042602 Bacteria 66246
117 Ga0466719_086113 3300042606 Bacteria 2749
118 Ga0466719_445360 3300042606 Bacteria 1835
119 Ga0466711_117551 3300042615 Bacteria 11311
120 Ga0466711_446219 3300042615 Bacteria 7500
121 Ga0466726_147634 3300042619 Bacteria 1078
122 Ga0466728_027538 3300042620 Bacteria 7294
123 Ga0466729_123526 3300042621 Bacteria 33019
124 JGI24702J35022_10218040 3300002462 Bacteria 1098
125 JGI24705J35276_12206528 3300002504 Bacteria 1723
126 Ga0466733_215888 3300042659 Bacteria 1330
127 Ga0123357_10078962 3300009784 Bacteria 4335
128 Ga0123353_10432656 3300010167 Bacteria 1945
129 Ga0415639_200761 3300038395 Bacteria 2076
130 Ga0466656_197778 3300042550 Bacteria 1360
131 Ga0466692_147996 3300042591 Bacteria 7875
132 Ga0466694_219633 3300042594 Bacteria 1113
133 Ga0466696_176263 3300042596 Bacteria 1586
134 Ga0466696_219440 3300042596 Bacteria 17310
135 Ga0466696_278891 3300042596 Bacteria 171866
136 Ga0466735_017780 3300042624 Bacteria 2473
137 Ga0466703_019316 3300042636 Bacteria 19998
138 Ga0466706_017961 3300042599 Bacteria 2793
139 Ga0466700_377078 3300042600 Bacteria 1520
140 Ga0466707_016104 3300042601 Bacteria 15234
141 Ga0466707_050196 3300042601 Bacteria 4702
142 Ga0466713_012307 3300042602 Bacteria 58290
143 Ga0466713_018694 3300042602 Bacteria 10231
144 Ga0466716_020109 3300042605 Bacteria 1187
145 Ga0466719_112981 3300042606 Bacteria 1726
146 Ga0466711_046639 3300042615 Bacteria 1589
147 Ga0466711_109380 3300042615 Bacteria 31839
148 Ga0466718_055065 3300042617 Bacteria 2168
149 IMNBL1DRAFT_c0019891 3300000062 Bacteria 2735
150 JGI24702J35022_10000746 3300002462 Bacteria 20053
151 Ga0123355_10000772 3300009826 Bacteria 43687
152 Ga0123356_10090082 3300010049 Unclassified 2920
153 Ga0123353_10116236 3300010167 Bacteria 4305
154 Ga0123354_10000799 3300010882 Bacteria 34399
155 Ga0466691_022426 3300042593 Bacteria 71333
156 Ga0466696_012130 3300042596 Bacteria 5591
157 Ga0466735_010719 3300042624 Bacteria 22017
158 Ga0466703_254148 3300042636 Bacteria 23220
159 Ga0466704_199203 3300042643 Bacteria 10322
160 Ga0466725_014257 3300042654 Bacteria 50961
161 Ga0466713_060305 3300042602 Bacteria 8341
162 Ga0466719_111248 3300042606 Bacteria 3179
163 Ga0466722_244504 3300042609 Bacteria 11832
164 Ga0466705_506100 3300042612 Bacteria 25887
165 Ga0466711_018539 3300042615 Bacteria 5856
166 Ga0466711_123903 3300042615 Bacteria 10875
167 Ga0466715_015265 3300042616 Bacteria 3511
168 Ga0466715_471395 3300042616 Bacteria 5564
169 Ga0466728_078813 3300042620 Bacteria 17956
170 2227542421 2225789004 Bacteria 2971
171 Ga0068305_10009014 3300005083 Bacteria 53295
172 Ga0072941_1745038 3300005201 Bacteria 945
173 Ga0466705_221760 3300042612 Bacteria 3495
174 Ga0466656_296751 3300042550 Bacteria 1013
175 Ga0466691_065526 3300042593 Bacteria 12371
176 Ga0466696_150205 3300042596 Bacteria 10583
177 Ga0466696_304520 3300042596 Bacteria 7469
178 Ga0466696_372228 3300042596 Bacteria 1267
179 Ga0466735_038152 3300042624 Bacteria 2084
180 Ga0466735_204671 3300042624 Unclassified 3682
181 Ga0466735_223403 3300042624 Bacteria 2889
182 Ga0466703_253942 3300042636 Bacteria 6239
183 Ga0466704_126212 3300042643 Bacteria 12717
184 Ga0466704_290303 3300042643 Bacteria 4822
185 Ga0466709_168803 3300042648 Bacteria 2116
186 Ga0466708_040680 3300042652 Bacteria 29797
187 Ga0466725_275364 3300042654 Bacteria 1725
188 Ga0466727_228551 3300042655 Bacteria 2893
189 Ga0466701_032786 3300042598 Bacteria 1019
190 Ga0466701_083821 3300042598 Bacteria 1337
191 Ga0466717_013203 3300042604 Bacteria 1569
192 Ga0466716_026310 3300042605 Bacteria 16932
193 Ga0466716_076910 3300042605 Bacteria 11677
194 Ga0466722_116286 3300042609 Bacteria 3649
195 Ga0466722_261518 3300042609 Bacteria 1286
196 Ga0466715_254628 3300042616 Bacteria 21177
197 Ga0466728_282213 3300042620 Bacteria 9551
198 IMNBL1DRAFT_c0003327 3300000062 Bacteria 10435
199 IMNBL1DRAFT_c0055750 3300000062 Bacteria 1216
200 JGI24702J35022_10435374 3300002462 Bacteria 797
201 JGI24705J35276_12237451 3300002504 Bacteria 11168
202 Ga0103265_1007724 3300007068 Bacteria 2534
203 Ga0103267_1010480 3300007190 Unclassified 7421

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042608 Ga0466721_075675 Ga0466721_075675_7167_7580 137
2 3300000062 IMNBL1DRAFT_c0021349 IMNBL1DRAFT_00213494 138
3 3300002462 JGI24702J35022_10147576 JGI24702J35022_101475762 138
4 3300009826 Ga0123355_10000772 Ga0123355_1000077213 138
5 3300042616 Ga0466715_015265 Ga0466715_015265_552_968 138
6 3300042636 Ga0466703_241786 Ga0466703_241786_326_742 138
7 3300010167 Ga0123353_10116236 Ga0123353_101162361 139
8 3300042602 Ga0466713_060305 Ga0466713_060305_4655_5074 139
9 3300042609 Ga0466722_059494 Ga0466722_059494_361_780 139
10 3300042609 Ga0466722_116286 Ga0466722_116286_343_762 139
11 3300042615 Ga0466711_018539 Ga0466711_018539_1237_1656 139
12 3300042616 Ga0466715_471395 Ga0466715_471395_4724_5143 139
13 iso_pr_bacteria 2920168565 2920169649 139
14 3300005201 Ga0072941_1113299 Ga0072941_11132995 140
15 3300038395 Ga0415639_200761 Ga0415639_200761_1051_1473 140
16 3300042591 Ga0466692_077218 Ga0466692_077218_939_1361 140
17 3300042596 Ga0466696_219440 Ga0466696_219440_3187_3609 140
18 3300042596 Ga0466696_304520 Ga0466696_304520_4407_4829 140
19 3300042601 Ga0466707_012433 Ga0466707_012433_197_619 140
20 3300042601 Ga0466707_050196 Ga0466707_050196_1693_2115 140
21 3300042620 Ga0466728_027538 Ga0466728_027538_3586_4008 140
22 3300042625 Ga0466730_103185 Ga0466730_103185_42896_43318 140
23 3300042636 Ga0466703_253942 Ga0466703_253942_3435_3857 140
24 3300042643 Ga0466704_287710 Ga0466704_287710_6008_6430 140
25 3300042649 Ga0466724_46543 Ga0466724_46543_262487_262909 140
26 3300042652 Ga0466708_040680 Ga0466708_040680_2281_2703 140
27 3300042654 Ga0466725_443278 Ga0466725_443278_740_1162 140
28 iso_pr_bacteria 2687453786 2690173890 140
29 iso_pr_bacteria 2864831662 2864835870 140
30 2225789004 2227542421 2228065253 141
31 3300010049 Ga0123356_10447442 Ga0123356_104474422 141
32 3300042599 Ga0466706_001642 Ga0466706_001642_7195_7620 141
33 3300042601 Ga0466707_111686 Ga0466707_111686_1942_2367 141
34 3300042606 Ga0466719_111248 Ga0466719_111248_2139_2564 141
35 3300042624 Ga0466735_010719 Ga0466735_010719_10130_10555 141
36 3300042624 Ga0466735_223403 Ga0466735_223403_1530_1955 141
37 3300042643 Ga0466704_558196 Ga0466704_558196_2469_2894 141
38 3300000062 IMNBL1DRAFT_c0003515 IMNBL1DRAFT_00035153 142
39 3300002462 JGI24702J35022_10218040 JGI24702J35022_102180401 142
40 3300010167 Ga0123353_10754201 Ga0123353_107542012 142
41 3300042550 Ga0466656_197778 Ga0466656_197778_80_508 142
42 3300042594 Ga0466694_219633 Ga0466694_219633_53_481 142
43 3300042596 Ga0466696_159350 Ga0466696_159350_794_1222 142
44 3300042596 Ga0466696_176263 Ga0466696_176263_533_961 142
45 3300042596 Ga0466696_278891 Ga0466696_278891_160277_160705 142
46 3300042596 Ga0466696_372228 Ga0466696_372228_290_718 142
47 3300042598 Ga0466701_083821 Ga0466701_083821_712_1140 142
48 3300042600 Ga0466700_377078 Ga0466700_377078_154_582 142
49 3300042602 Ga0466713_100528 Ga0466713_100528_124833_125261 142
50 3300042609 Ga0466722_244504 Ga0466722_244504_7884_8312 142
51 3300042613 Ga0466710_159728 Ga0466710_159728_10739_11167 142
52 3300042617 Ga0466718_055065 Ga0466718_055065_1678_2106 142
53 3300042643 Ga0466704_082193 Ga0466704_082193_4258_4686 142
54 3300042643 Ga0466704_207509 Ga0466704_207509_11938_12366 142
55 3300042643 Ga0466704_558352 Ga0466704_558352_950_1378 142
56 3300042655 Ga0466727_075634 Ga0466727_075634_2374_2802 142
57 3300042659 Ga0466733_140351 Ga0466733_140351_6705_7133 142
58 iso_pr_bacteria 2940195863 2940196751 142
59 iso_pr_bacteria 3004667792 3004668650 142
60 3300002462 JGI24702J35022_10435374 JGI24702J35022_104353741 143
61 3300005201 Ga0072941_1745038 Ga0072941_17450381 143
62 3300007068 Ga0103265_1007724 Ga0103265_10077242 143
63 3300007129 Ga0102734_1000277 Ga0102734_10002773 143
64 3300007190 Ga0103267_1010480 Ga0103267_10104802 143
65 3300042593 Ga0466691_021365 Ga0466691_021365_12002_12433 143
66 3300042593 Ga0466691_022426 Ga0466691_022426_8296_8727 143
67 3300042596 Ga0466696_306565 Ga0466696_306565_1716_2147 143
68 3300042602 Ga0466713_018694 Ga0466713_018694_6715_7146 143
69 3300042602 Ga0466713_103922 Ga0466713_103922_21078_21509 143
70 3300042603 Ga0466714_137522 Ga0466714_137522_996_1427 143
71 3300042606 Ga0466719_133938 Ga0466719_133938_916_1347 143
72 3300042618 Ga0466723_103648 Ga0466723_103648_12034_12465 143
73 3300042620 Ga0466728_079520 Ga0466728_079520_22631_23062 143
74 3300042624 Ga0466735_038152 Ga0466735_038152_1351_1782 143
75 3300042624 Ga0466735_063754 Ga0466735_063754_1294_1725 143
76 3300042624 Ga0466735_078782 Ga0466735_078782_325_756 143
77 3300042624 Ga0466735_204671 Ga0466735_204671_2416_2847 143
78 3300042636 Ga0466703_254148 Ga0466703_254148_13327_13758 143
79 3300042652 Ga0466708_074679 Ga0466708_074679_2189_2620 143
80 3300056842 Ga0562377_0004 Ga0562377_0004_743357_743788 143
81 iso_pr_bacteria 2820778767 2820780499 143
82 iso_pr_bacteria 3004672520 3004676155 143
83 2225789004 2227489633 2227959981 144
84 3300000062 IMNBL1DRAFT_c0016964 IMNBL1DRAFT_00169642 144
85 3300042550 Ga0466656_296751 Ga0466656_296751_69_503 144
86 3300042590 Ga0466690_086237 Ga0466690_086237_4572_5006 144
87 3300042590 Ga0466690_325412 Ga0466690_325412_21082_21516 144
88 3300042591 Ga0466692_147996 Ga0466692_147996_1155_1589 144
89 3300042592 Ga0466693_252782 Ga0466693_252782_2717_3151 144
90 3300042592 Ga0466693_371460 Ga0466693_371460_488_922 144
91 3300042593 Ga0466691_025023 Ga0466691_025023_4630_5064 144
92 3300042593 Ga0466691_065526 Ga0466691_065526_7544_7978 144
93 3300042593 Ga0466691_162389 Ga0466691_162389_884_1318 144
94 3300042596 Ga0466696_150205 Ga0466696_150205_5092_5526 144
95 3300042596 Ga0466696_358309 Ga0466696_358309_37_471 144
96 3300042598 Ga0466701_032786 Ga0466701_032786_199_633 144
97 3300042599 Ga0466706_054670 Ga0466706_054670_43447_43881 144
98 3300042601 Ga0466707_016104 Ga0466707_016104_6847_7281 144
99 3300042601 Ga0466707_290896 Ga0466707_290896_485_919 144
100 3300042602 Ga0466713_009775 Ga0466713_009775_60083_60517 144
101 3300042604 Ga0466717_013203 Ga0466717_013203_35_469 144
102 3300042605 Ga0466716_076910 Ga0466716_076910_2749_3183 144
103 3300042606 Ga0466719_112981 Ga0466719_112981_887_1321 144
104 3300042606 Ga0466719_151669 Ga0466719_151669_16_450 144
105 3300042609 Ga0466722_051355 Ga0466722_051355_23254_23688 144
106 3300042609 Ga0466722_136407 Ga0466722_136407_10287_10721 144
107 3300042609 Ga0466722_146807 Ga0466722_146807_4649_5083 144
108 3300042612 Ga0466705_221760 Ga0466705_221760_315_749 144
109 3300042612 Ga0466705_335705 Ga0466705_335705_1330_1764 144
110 3300042612 Ga0466705_376125 Ga0466705_376125_5094_5528 144
111 3300042612 Ga0466705_506100 Ga0466705_506100_11849_12283 144
112 3300042615 Ga0466711_046639 Ga0466711_046639_707_1141 144
113 3300042615 Ga0466711_109380 Ga0466711_109380_22931_23365 144
114 3300042615 Ga0466711_117551 Ga0466711_117551_3599_4033 144
115 3300042615 Ga0466711_123903 Ga0466711_123903_7871_8305 144
116 3300042615 Ga0466711_154251 Ga0466711_154251_2739_3173 144
117 3300042616 Ga0466715_007714 Ga0466715_007714_10311_10745 144
118 3300042616 Ga0466715_037900 Ga0466715_037900_30319_30753 144
119 3300042616 Ga0466715_159345 Ga0466715_159345_6051_6485 144
120 3300042616 Ga0466715_254628 Ga0466715_254628_10834_11268 144
121 3300042616 Ga0466715_613585 Ga0466715_613585_8243_8677 144
122 3300042618 Ga0466723_053207 Ga0466723_053207_1862_2296 144
123 3300042619 Ga0466726_147634 Ga0466726_147634_19_453 144
124 3300042619 Ga0466726_187244 Ga0466726_187244_4333_4767 144
125 3300042622 Ga0466731_157844 Ga0466731_157844_685_1119 144
126 3300042624 Ga0466735_182589 Ga0466735_182589_344_778 144
127 3300042624 Ga0466735_198945 Ga0466735_198945_514_948 144
128 3300042636 Ga0466703_019316 Ga0466703_019316_8957_9391 144
129 3300042636 Ga0466703_082546 Ga0466703_082546_6677_7111 144
130 3300042636 Ga0466703_307651 Ga0466703_307651_5753_6187 144
131 3300042643 Ga0466704_098066 Ga0466704_098066_11537_11971 144
132 3300042643 Ga0466704_199203 Ga0466704_199203_2814_3248 144
133 3300042643 Ga0466704_374004 Ga0466704_374004_10973_11407 144
134 3300042643 Ga0466704_575698 Ga0466704_575698_2101_2535 144
135 3300042648 Ga0466709_033872 Ga0466709_033872_1917_2351 144
136 3300042648 Ga0466709_143793 Ga0466709_143793_3293_3727 144
137 3300042648 Ga0466709_191028 Ga0466709_191028_792_1226 144
138 3300042654 Ga0466725_014257 Ga0466725_014257_32797_33231 144
139 3300042654 Ga0466725_275364 Ga0466725_275364_180_614 144
140 3300042659 Ga0466733_088826 Ga0466733_088826_19294_19728 144
141 3300000062 IMNBL1DRAFT_c0055750 IMNBL1DRAFT_00557502 145
142 3300002504 JGI24705J35276_12206528 JGI24705J35276_122065282 145
143 3300002504 JGI24705J35276_12237451 JGI24705J35276_122374518 145
144 3300005083 Ga0068305_10009014 Ga0068305_1000901439 145
145 3300010049 Ga0123356_10532773 Ga0123356_105327732 145
146 3300010167 Ga0123353_10009487 Ga0123353_100094872 145
147 3300010882 Ga0123354_10000799 Ga0123354_1000079935 145
148 3300042605 Ga0466716_026310 Ga0466716_026310_3549_3986 145
149 3300042609 Ga0466722_005794 Ga0466722_005794_504_941 145
150 3300042609 Ga0466722_215606 Ga0466722_215606_920_1357 145
151 3300042611 Ga0466697_247837 Ga0466697_247837_688_1125 145
152 3300042624 Ga0466735_168988 Ga0466735_168988_211_648 145
153 3300042655 Ga0466727_228551 Ga0466727_228551_1983_2420 145
154 3300042659 Ga0466733_215888 Ga0466733_215888_26_463 145
155 3300000062 IMNBL1DRAFT_c0003327 IMNBL1DRAFT_00033272 146
156 3300000062 IMNBL1DRAFT_c0019891 IMNBL1DRAFT_00198912 146
157 3300010167 Ga0123353_10005186 Ga0123353_1000518617 146
158 3300010167 Ga0123353_11471528 Ga0123353_114715282 146
159 3300024582 Ga0265387_1001491 Ga0265387_10014914 146
160 3300042596 Ga0466696_012130 Ga0466696_012130_5069_5509 146
161 3300042620 Ga0466728_282213 Ga0466728_282213_6951_7391 146
162 iso_pr_bacteria 2820768849 2820769870 146
163 iso_pr_bacteria 2820774381 2820774913 146
164 3300002462 JGI24702J35022_10000746 JGI24702J35022_1000074612 147
165 3300002462 JGI24702J35022_10016701 JGI24702J35022_100167013 147
166 3300002462 JGI24702J35022_10205364 JGI24702J35022_102053642 147
167 3300009784 Ga0123357_10078962 Ga0123357_100789623 147
168 3300010167 Ga0123353_10432656 Ga0123353_104326562 147
169 3300042596 Ga0466696_454466 Ga0466696_454466_597_1040 147
170 3300042599 Ga0466706_012545 Ga0466706_012545_162_605 147
171 3300042600 Ga0466700_036073 Ga0466700_036073_1623_2066 147
172 3300042601 Ga0466707_222304 Ga0466707_222304_230_673 147
173 3300042603 Ga0466714_098947 Ga0466714_098947_3941_4384 147
174 3300042609 Ga0466722_261518 Ga0466722_261518_184_627 147
175 3300042648 Ga0466709_156488 Ga0466709_156488_62999_63442 147
176 3300042655 Ga0466727_225961 Ga0466727_225961_13024_13467 147
177 3300002462 JGI24702J35022_10009089 JGI24702J35022_100090893 148
178 3300002462 JGI24702J35022_10022691 JGI24702J35022_100226916 148
179 3300042599 Ga0466706_017961 Ga0466706_017961_1119_1565 148
180 3300042606 Ga0466719_445360 Ga0466719_445360_532_978 148
181 3300042609 Ga0466722_240768 Ga0466722_240768_13982_14428 148
182 3300042659 Ga0466733_170029 Ga0466733_170029_5460_5906 148
183 3300042615 Ga0466711_446219 Ga0466711_446219_2855_3304 149
184 3300042624 Ga0466735_017780 Ga0466735_017780_1261_1710 149
185 3300042656 Ga0466732_086064 Ga0466732_086064_2534_2983 149
186 iso_pr_bacteria 2609459943 2610740411 149
187 iso_pr_bacteria 2830041218 2830043640 149
188 3300005200 Ga0072940_1122540 Ga0072940_11225403 150
189 3300042601 Ga0466707_287159 Ga0466707_287159_564_1016 150
190 3300042621 Ga0466729_123526 Ga0466729_123526_1563_2015 150
191 3300042648 Ga0466709_012440 Ga0466709_012440_1862_2314 150
192 3300042599 Ga0466706_039310 Ga0466706_039310_13661_14116 151
193 3300042602 Ga0466713_012307 Ga0466713_012307_48877_49332 151
194 3300042652 Ga0466708_237408 Ga0466708_237408_20809_21267 152
195 3300042612 Ga0466705_384051 Ga0466705_384051_3840_4301 153
196 3300042618 Ga0466723_334830 Ga0466723_334830_11609_12070 153
197 3300042593 Ga0466691_077664 Ga0466691_077664_9063_9527 154
198 3300042593 Ga0466691_181397 Ga0466691_181397_1088_1552 154
199 3300042605 Ga0466716_020109 Ga0466716_020109_543_1007 154
200 3300042606 Ga0466719_086113 Ga0466719_086113_202_666 154
201 3300042616 Ga0466715_281564 Ga0466715_281564_592_1056 154
202 3300042620 Ga0466728_078813 Ga0466728_078813_1147_1611 154
203 3300042643 Ga0466704_126212 Ga0466704_126212_4853_5317 154
204 3300042643 Ga0466704_290303 Ga0466704_290303_2734_3198 154
205 3300042648 Ga0466709_198981 Ga0466709_198981_475_939 154
206 3300042652 Ga0466708_360582 Ga0466708_360582_10158_10622 154
207 3300042612 Ga0466705_232153 Ga0466705_232153_14598_15086 155
208 3300010049 Ga0123356_10090082 Ga0123356_100900821 157
209 3300042643 Ga0466704_077855 Ga0466704_077855_12636_13109 157
210 3300042643 Ga0466704_293633 Ga0466704_293633_3459_3947 162
211 3300042591 Ga0466692_091832 Ga0466692_091832_16275_16766 163
212 3300007080 Ga0102735_1000448 Ga0102735_10004482 169
213 3300042606 Ga0466719_323961 Ga0466719_323961_6631_7146 171
214 3300042648 Ga0466709_168803 Ga0466709_168803_833_1354 173

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 32 137 0.93
PF14437 MafB19-deam MafB19-like deaminase 43 143 0.89
PF14439 Bd3614-deam Bd3614-like deaminase 87 136 0.84
PF18750 SNAD4 Secreted Novel AID/APOBEC-like Deaminase 4 88 128 0.83
PF08210 APOBEC_N APOBEC-like N-terminal domain 89 128 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.