Protein Family IF09430

Metagenome Isolate
129 Members
35 Samples
120 Scaffolds
211.98 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_230455|Ga0466704_230455_605_1327
Length
240 aa
Sequence
MKKTAPDMLPNPHEQHLKKRRTDLMANDELKYYGKIPEPTLRRLPWYLAYVKLLKGKGDSVVSSTQIAKEINVDASQVAKDLSFVNISGKTRVGYGIDALADILDSFLGFTSQHKAFLFGVGQLGAALMRDSGLNQYGVEIVAGFDIRNDVVGKEIDGIPVFPMDTLPEKQKEYGAAIGILTVPVEKAQEVTDFIIANDIKTLWNFTPFRIRVPEKVVVQNTSIYAHLAVMFNRMNENSK

📊 Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Blattidae 22.9%
Termopsidae 11.4%
Termitidae 8.6%
Unclassified 5.7%
Passalidae 5.7%
Hodotermitidae 2.9%
Rhinotermitidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
3 2920168565 Paludibacter sp. 221 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2923982719 Parabacteroides sp. 52 Isolate Blattidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
16 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
17 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
18 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
30 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_265105 3300042601 Bacteria 17266
2 Ga0123354_10114610 3300010882 Bacteria 3529
3 Ga0466690_246577 3300042590 Bacteria 16883
4 Ga0466691_148747 3300042593 Bacteria 15449
5 Ga0466723_059005 3300042618 Bacteria 62633
6 Ga0466726_362859 3300042619 Bacteria 1972
7 Ga0466728_399396 3300042620 Bacteria 7766
8 Ga0466735_215515 3300042624 Bacteria 3575
9 Ga0466735_233659 3300042624 Bacteria 1540
10 Ga0466703_202703 3300042636 Bacteria 8925
11 Ga0466704_228006 3300042643 Bacteria 10392
12 Ga0466708_120576 3300042652 Bacteria 34134
13 Ga0466727_001589 3300042655 Bacteria 4634
14 Ga0466727_197055 3300042655 Bacteria 11060
15 Ga0466705_005241 3300042612 Bacteria 8467
16 Ga0466733_078806 3300042659 Bacteria 7143
17 Ga0466706_029973 3300042599 Bacteria 5825
18 Ga0466719_113132 3300042606 Bacteria 2524
19 Ga0466690_037512 3300042590 Bacteria 4211
20 Ga0466691_060692 3300042593 Bacteria 22870
21 Ga0466696_077671 3300042596 Bacteria 18917
22 Ga0466696_164484 3300042596 Bacteria 3472
23 Ga0466696_321318 3300042596 Bacteria 1980
24 Ga0466711_514103 3300042615 Bacteria 6359
25 Ga0466715_056557 3300042616 Bacteria 7288
26 Ga0466715_106437 3300042616 Bacteria 8386
27 Ga0466703_202757 3300042636 Bacteria 8523
28 Ga0466703_217268 3300042636 Bacteria 30172
29 Ga0466703_233949 3300042636 Bacteria 12778
30 Ga0466704_106814 3300042643 Bacteria 18291
31 Ga0466704_282969 3300042643 Bacteria 8623
32 Ga0466704_418711 3300042643 Bacteria 6628
33 Ga0466705_143850 3300042612 Bacteria 38978
34 Ga0466716_203273 3300042605 Bacteria 2364
35 Ga0466719_186573 3300042606 Bacteria 15608
36 Ga0466690_172738 3300042590 Bacteria 57212
37 Ga0466691_020503 3300042593 Bacteria 5466
38 Ga0466696_198573 3300042596 Unclassified 3746
39 Ga0466696_323500 3300042596 Bacteria 24747
40 Ga0466711_057542 3300042615 Bacteria 70908
41 Ga0466711_277276 3300042615 Bacteria 5509
42 Ga0466729_285797 3300042621 Bacteria 17692
43 Ga0466735_078282 3300042624 Bacteria 1205
44 Ga0466703_150283 3300042636 Bacteria 2603
45 Ga0466703_165459 3300042636 Bacteria 12745
46 Ga0466703_407045 3300042636 Bacteria 5949
47 Ga0466709_064196 3300042648 Bacteria 3277
48 Ga0466709_380194 3300042648 Bacteria 9690
49 Ga0466727_265103 3300042655 Bacteria 3692
50 2227582948 2225789004 Bacteria 13326
51 Ga0123357_10000910 3300009784 Bacteria 30052
52 Ga0466705_025497 3300042612 Bacteria 5436
53 Ga0466715_040385 3300042616 Bacteria 43736
54 Ga0466723_031578 3300042618 Bacteria 25603
55 Ga0466723_089568 3300042618 Bacteria 54083
56 Ga0466729_287866 3300042621 Bacteria 1886
57 IMNBL1DRAFT_c0001719 3300000062 Bacteria 16090
58 IMNBL1DRAFT_c0003460 3300000062 Bacteria 10134
59 Ga0068302_10519094 3300005071 Bacteria 2089
60 Ga0466705_119312 3300042612 Bacteria 10871
61 Ga0466707_312039 3300042601 Bacteria 9254
62 Ga0466716_390504 3300042605 Bacteria 5665
63 Ga0466719_072882 3300042606 Bacteria 12516
64 Ga0466690_144121 3300042590 Bacteria 19950
65 Ga0466711_040682 3300042615 Bacteria 14896
66 Ga0466711_211791 3300042615 Bacteria 4556
67 Ga0466726_423872 3300042619 Bacteria 2193
68 Ga0466703_314103 3300042636 Bacteria 9653
69 Ga0466704_155344 3300042643 Bacteria 13326
70 Ga0466704_230455 3300042643 Bacteria 5728
71 Ga0466704_230588 3300042643 Bacteria 2605
72 Ga0466709_163587 3300042648 Bacteria 2870
73 Ga0466708_046243 3300042652 Bacteria 10646
74 Ga0466708_173680 3300042652 Bacteria 20637
75 Ga0466727_305508 3300042655 Bacteria 2958
76 2227313039 2225789004 Bacteria 1201
77 Ga0466705_078038 3300042612 Bacteria 10688
78 Ga0466733_055799 3300042659 Bacteria 106016
79 Ga0466707_050302 3300042601 Bacteria 3601
80 Ga0466691_034658 3300042593 Bacteria 6378
81 Ga0466696_004662 3300042596 Bacteria 3206
82 Ga0466715_359379 3300042616 Bacteria 8402
83 Ga0466715_602785 3300042616 Bacteria 12322
84 Ga0466723_230949 3300042618 Bacteria 4083
85 Ga0466726_111970 3300042619 Bacteria 2388
86 Ga0466704_251609 3300042643 Bacteria 45182
87 Ga0466727_151974 3300042655 Bacteria 9461
88 IMNBL1DRAFT_c0001009 3300000062 Bacteria 21721
89 Ga0466705_233444 3300042612 Bacteria 9951
90 Ga0466733_130571 3300042659 Bacteria 17288
91 Ga0466716_103220 3300042605 Bacteria 15494
92 Ga0466716_335632 3300042605 Bacteria 16705
93 Ga0466690_038698 3300042590 Bacteria 19777
94 Ga0466711_324855 3300042615 Bacteria 13815
95 Ga0466729_226665 3300042621 Bacteria 2048
96 Ga0466735_056066 3300042624 Bacteria 2066
97 Ga0466703_075697 3300042636 Bacteria 9217
98 Ga0466704_125322 3300042643 Bacteria 12471
99 Ga0466704_341998 3300042643 Unclassified 12193
100 Ga0466709_096536 3300042648 Bacteria 31729
101 2227280803 2225789004 Bacteria 6812
102 IMNBL1DRAFT_c0011800 3300000062 Bacteria 4053
103 Ga0466705_117307 3300042612 Bacteria 31530
104 Ga0466706_195384 3300042599 Bacteria 1953
105 Ga0466707_101068 3300042601 Bacteria 3656
106 Ga0466716_121228 3300042605 Bacteria 19334
107 Ga0466716_297926 3300042605 Bacteria 6297
108 Ga0466719_183090 3300042606 Bacteria 15058
109 Ga0466696_071660 3300042596 Bacteria 2928
110 Ga0466711_241851 3300042615 Bacteria 11602
111 Ga0466715_017736 3300042616 Bacteria 12115
112 Ga0466715_509861 3300042616 Bacteria 18242
113 Ga0466723_199680 3300042618 Bacteria 21029
114 Ga0466728_330389 3300042620 Bacteria 1217
115 Ga0466728_459283 3300042620 Bacteria 2647
116 Ga0466729_060358 3300042621 Bacteria 13859
117 Ga0466703_098605 3300042636 Bacteria 6901
118 IMNBL1DRAFT_c0001920 3300000062 Bacteria 15041
119 IMNBL1DRAFT_c0030730 3300000062 Bacteria 1964
120 Ga0068302_10229216 3300005071 Bacteria 2275

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_130571 Ga0466733_130571_7736_8389 193
2 3300000062 IMNBL1DRAFT_c0001920 IMNBL1DRAFT_00019208 194
3 3300042636 Ga0466703_233949 Ga0466703_233949_6483_7121 195
4 3300042621 Ga0466729_285797 Ga0466729_285797_16612_17253 199
5 3300042636 Ga0466703_150283 Ga0466703_150283_863_1513 201
6 3300042590 Ga0466690_038698 Ga0466690_038698_10917_11573 202
7 3300042590 Ga0466690_246577 Ga0466690_246577_3381_4034 202
8 3300042599 Ga0466706_195384 Ga0466706_195384_294_944 202
9 3300042618 Ga0466723_230949 Ga0466723_230949_358_1011 202
10 3300042619 Ga0466726_362859 Ga0466726_362859_577_1227 202
11 3300042593 Ga0466691_148747 Ga0466691_148747_3683_4339 203
12 3300042601 Ga0466707_101068 Ga0466707_101068_2526_3179 203
13 3300042605 Ga0466716_103220 Ga0466716_103220_3585_4241 203
14 3300042605 Ga0466716_390504 Ga0466716_390504_3858_4514 203
15 3300042612 Ga0466705_233444 Ga0466705_233444_7143_7793 203
16 3300042616 Ga0466715_509861 Ga0466715_509861_6730_7386 203
17 3300042618 Ga0466723_199680 Ga0466723_199680_5964_6575 203
18 3300042624 Ga0466735_056066 Ga0466735_056066_197_853 203
19 3300042624 Ga0466735_078282 Ga0466735_078282_71_682 203
20 3300042636 Ga0466703_314103 Ga0466703_314103_1500_2156 203
21 3300042643 Ga0466704_125322 Ga0466704_125322_9045_9695 203
22 3300042648 Ga0466709_064196 Ga0466709_064196_1729_2385 203
23 3300042648 Ga0466709_163587 Ga0466709_163587_1113_1769 203
24 3300042655 Ga0466727_001589 Ga0466727_001589_1821_2432 203
25 2225789004 2227582948 2228136106 204
26 3300000062 IMNBL1DRAFT_c0001719 IMNBL1DRAFT_000171915 204
27 3300005071 Ga0068302_10229216 Ga0068302_102292162 204
28 3300005071 Ga0068302_10519094 Ga0068302_105190943 204
29 3300042596 Ga0466696_004662 Ga0466696_004662_2463_3116 204
30 3300042601 Ga0466707_265105 Ga0466707_265105_6739_7392 204
31 3300042606 Ga0466719_113132 Ga0466719_113132_1695_2309 204
32 3300042615 Ga0466711_324855 Ga0466711_324855_5880_6536 204
33 3300042616 Ga0466715_056557 Ga0466715_056557_3391_4005 204
34 3300042620 Ga0466728_330389 Ga0466728_330389_376_1032 204
35 3300042636 Ga0466703_202757 Ga0466703_202757_4565_5221 204
36 3300042652 Ga0466708_046243 Ga0466708_046243_6274_6930 204
37 3300000062 IMNBL1DRAFT_c0001009 IMNBL1DRAFT_00010099 205
38 3300009784 Ga0123357_10000910 Ga0123357_100009103 205
39 3300042655 Ga0466727_197055 Ga0466727_197055_7143_7793 205
40 3300042636 Ga0466703_202703 Ga0466703_202703_6246_6899 206
41 3300042655 Ga0466727_305508 Ga0466727_305508_2265_2915 206
42 3300042593 Ga0466691_020503 Ga0466691_020503_3722_4417 207
43 3300042601 Ga0466707_050302 Ga0466707_050302_2711_3358 207
44 3300042619 Ga0466726_111970 Ga0466726_111970_944_1594 207
45 3300042643 Ga0466704_282969 Ga0466704_282969_7131_7826 207
46 3300042655 Ga0466727_151974 Ga0466727_151974_477_1127 207
47 3300042616 Ga0466715_106437 Ga0466715_106437_1781_2476 208
48 3300042624 Ga0466735_233659 Ga0466735_233659_83_739 208
49 3300042636 Ga0466703_165459 Ga0466703_165459_4668_5321 208
50 3300042643 Ga0466704_251609 Ga0466704_251609_6289_6957 208
51 3300042596 Ga0466696_198573 Ga0466696_198573_378_1079 209
52 3300042615 Ga0466711_514103 Ga0466711_514103_1191_1847 209
53 3300042618 Ga0466723_089568 Ga0466723_089568_41272_41901 209
54 3300042621 Ga0466729_287866 Ga0466729_287866_213_872 209
55 3300042615 Ga0466711_211791 Ga0466711_211791_612_1268 210
56 3300042601 Ga0466707_312039 Ga0466707_312039_6926_7561 211
57 3300042593 Ga0466691_060692 Ga0466691_060692_8430_9092 212
58 3300042615 Ga0466711_277276 Ga0466711_277276_1335_2018 212
59 3300042659 Ga0466733_055799 Ga0466733_055799_51940_52578 212
60 3300010882 Ga0123354_10114610 Ga0123354_101146104 213
61 3300042615 Ga0466711_241851 Ga0466711_241851_5216_5857 213
62 3300042596 Ga0466696_077671 Ga0466696_077671_11549_12193 214
63 3300042636 Ga0466703_098605 Ga0466703_098605_5430_6074 214
64 3300042643 Ga0466704_418711 Ga0466704_418711_5008_5652 214
65 iso_pr_bacteria 2820778767 2820779631 214
66 2225789004 2227280803 2227732668 215
67 2225789004 2227313039 2227762413 215
68 3300042599 Ga0466706_029973 Ga0466706_029973_3729_4376 215
69 3300042616 Ga0466715_359379 Ga0466715_359379_7411_8058 215
70 3300042590 Ga0466690_144121 Ga0466690_144121_2109_2759 216
71 3300042596 Ga0466696_321318 Ga0466696_321318_495_1145 216
72 3300042605 Ga0466716_203273 Ga0466716_203273_398_1048 216
73 3300042606 Ga0466719_183090 Ga0466719_183090_2194_2844 216
74 3300042612 Ga0466705_025497 Ga0466705_025497_4457_5107 216
75 3300042615 Ga0466711_040682 Ga0466711_040682_2746_3396 216
76 3300042616 Ga0466715_602785 Ga0466715_602785_11477_12127 216
77 3300042624 Ga0466735_215515 Ga0466735_215515_1217_1867 216
78 3300042643 Ga0466704_155344 Ga0466704_155344_4475_5125 216
79 3300042643 Ga0466704_230588 Ga0466704_230588_725_1375 216
80 3300042643 Ga0466704_341998 Ga0466704_341998_11359_12054 216
81 3300042652 Ga0466708_173680 Ga0466708_173680_17373_18023 216
82 iso_pr_bacteria 2923982719 2923983338 216
83 iso_pr_bacteria 2940202316 2940203769 216
84 3300000062 IMNBL1DRAFT_c0003460 IMNBL1DRAFT_00034605 217
85 3300042590 Ga0466690_037512 Ga0466690_037512_3533_4186 217
86 3300042590 Ga0466690_172738 Ga0466690_172738_18853_19506 217
87 3300042593 Ga0466691_034658 Ga0466691_034658_4863_5516 217
88 3300042596 Ga0466696_323500 Ga0466696_323500_12623_13276 217
89 3300042605 Ga0466716_121228 Ga0466716_121228_8164_8817 217
90 3300042606 Ga0466719_072882 Ga0466719_072882_7426_8079 217
91 3300042612 Ga0466705_078038 Ga0466705_078038_3957_4637 217
92 3300042612 Ga0466705_117307 Ga0466705_117307_17039_17734 217
93 3300042612 Ga0466705_119312 Ga0466705_119312_7932_8585 217
94 3300042612 Ga0466705_143850 Ga0466705_143850_31017_31670 217
95 3300042618 Ga0466723_031578 Ga0466723_031578_6860_7513 217
96 3300042618 Ga0466723_059005 Ga0466723_059005_42409_43062 217
97 3300042619 Ga0466726_423872 Ga0466726_423872_125_778 217
98 3300042620 Ga0466728_399396 Ga0466728_399396_547_1200 217
99 3300042621 Ga0466729_226665 Ga0466729_226665_105_758 217
100 3300042643 Ga0466704_228006 Ga0466704_228006_3710_4390 217
101 3300042648 Ga0466709_096536 Ga0466709_096536_26487_27140 217
102 3300042648 Ga0466709_380194 Ga0466709_380194_989_1642 217
103 3300042655 Ga0466727_265103 Ga0466727_265103_17_670 217
104 3300042659 Ga0466733_078806 Ga0466733_078806_916_1569 217
105 iso_pr_bacteria 2940195863 2940197159 217
106 iso_pr_bacteria 2940199050 2940199230 217
107 iso_pr_bacteria 2940209341 2940210358 217
108 iso_pr_bacteria 2940346213 2940346292 217
109 3300042596 Ga0466696_071660 Ga0466696_071660_162_818 218
110 3300042605 Ga0466716_335632 Ga0466716_335632_2422_3078 218
111 3300042616 Ga0466715_017736 Ga0466715_017736_6885_7541 218
112 3300042616 Ga0466715_040385 Ga0466715_040385_31358_32014 218
113 3300042636 Ga0466703_075697 Ga0466703_075697_8374_9030 218
114 3300042615 Ga0466711_057542 Ga0466711_057542_53467_54126 219
115 3300042621 Ga0466729_060358 Ga0466729_060358_1289_1963 219
116 iso_pr_bacteria 2940371297 2940372634 219
117 3300042643 Ga0466704_106814 Ga0466704_106814_5578_6240 220
118 3300042652 Ga0466708_120576 Ga0466708_120576_10392_11054 220
119 3300042612 Ga0466705_005241 Ga0466705_005241_5373_6038 221
120 3300042636 Ga0466703_217268 Ga0466703_217268_7106_7774 222
121 3300042636 Ga0466703_407045 Ga0466703_407045_480_1151 223
122 3300000062 IMNBL1DRAFT_c0030730 IMNBL1DRAFT_00307302 225
123 3300042605 Ga0466716_297926 Ga0466716_297926_970_1680 225
124 3300042606 Ga0466719_186573 Ga0466719_186573_11142_11822 226
125 iso_pr_bacteria 2920168565 2920169198 226
126 3300000062 IMNBL1DRAFT_c0011800 IMNBL1DRAFT_00118003 229
127 3300042620 Ga0466728_459283 Ga0466728_459283_1559_2248 229
128 3300042596 Ga0466696_164484 Ga0466696_164484_2667_3365 232
129 3300042643 Ga0466704_230455 Ga0466704_230455_605_1327 240

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus 35 83 0.99
PF02629 CoA_binding CoA binding domain 112 208 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.