Protein Family IF09426

Metagenome Isolate
164 Members
40 Samples
160 Scaffolds
242.18 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_218273|Ga0466704_218273_10724_11536
Length
270 aa
Sequence
MKLLLVLGSDETSSLVSSYAEPLGFNLIRYRYVPKAMDNLEEIDPAGIIISARDFPRHWKVMVQYVRSSRPKEICPIILLKDDHFPLEETSKAFFLGVSGIVSEALEERTELDRLQGILSRYIPLDEKRKAQRHYAENWNRFGFLFSNPKDMTIISGEVKTISSSGLSFAPLNPDMLKNIRLNMELRECSLRAGSAILSPVCVLTRTGLVISLRFESFPENEQGILDKYLEGLPFLKLKNTLEEEKKKTEEKAFGLAEHDERAEELSPLD

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 34.2%
Unclassified 13.2%
Rhinotermitidae 7.9%
Termopsidae 7.9%

🌳 Taxonomy

Archaea 1
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_013726 3300042612 Bacteria 31494
2 Ga0466705_131799 3300042612 Bacteria 3271
3 Ga0466712_110973 3300042614 Bacteria 7456
4 Ga0466712_312622 3300042614 Bacteria 3323
5 Ga0466711_011556 3300042615 Bacteria 5493
6 Ga0466715_160435 3300042616 Bacteria 9799
7 Ga0466715_207366 3300042616 Bacteria 1443
8 Ga0466698_114127 3300042610 Bacteria 1463
9 Ga0466735_151264 3300042624 Bacteria 3853
10 Ga0466703_157107 3300042636 Bacteria 14256
11 Ga0466703_212476 3300042636 Bacteria 1384
12 Ga0466703_306142 3300042636 Bacteria 6822
13 Ga0466708_040913 3300042652 Bacteria 8879
14 Ga0466691_129261 3300042593 Bacteria 1149
15 Ga0466696_324431 3300042596 Bacteria 1443
16 Ga0466696_435701 3300042596 Bacteria 8824
17 Ga0466699_108387 3300042597 Bacteria 9555
18 JGI24698J34947_10008345 3300002449 Bacteria 5683
19 JGI24695J34938_10014535 3300002450 Archaea 4077
20 Ga0072941_1115775 3300005201 Bacteria 3688
21 Ga0466705_153285 3300042612 Bacteria 11777
22 Ga0466705_204736 3300042612 Bacteria 18205
23 Ga0123353_11438662 3300010167 Bacteria 883
24 Ga0466715_551351 3300042616 Bacteria 2451
25 Ga0466723_340980 3300042618 Bacteria 3505
26 Ga0466722_000578 3300042609 Bacteria 7207
27 Ga0466708_003759 3300042652 Bacteria 1053
28 Ga0466708_020351 3300042652 Bacteria 35169
29 Ga0466692_194237 3300042591 Bacteria 2335
30 Ga0466691_013250 3300042593 Bacteria 1695
31 Ga0466694_201000 3300042594 Bacteria 1237
32 AustNasuHG_c1015036 3300000089 Bacteria 2619
33 JGI24698J34947_10011756 3300002449 Bacteria 4806
34 JGI24698J34947_10084790 3300002449 Bacteria 1474
35 JGI24698J34947_10092234 3300002449 Bacteria 1386
36 Ga0466712_073940 3300042614 Bacteria 1639
37 Ga0466711_247962 3300042615 Bacteria 3365
38 Ga0466715_480821 3300042616 Bacteria 1039
39 Ga0466723_218601 3300042618 Bacteria 1048
40 Ga0466728_126782 3300042620 Bacteria 3567
41 Ga0466716_352671 3300042605 Bacteria 6365
42 Ga0466716_485148 3300042605 Bacteria 2822
43 Ga0466719_079168 3300042606 Bacteria 1552
44 Ga0466703_009073 3300042636 Unclassified 3285
45 Ga0466704_140988 3300042643 Bacteria 10220
46 Ga0466709_172904 3300042648 Bacteria 14335
47 Ga0466727_243860 3300042655 Bacteria 15153
48 Ga0466690_217407 3300042590 Bacteria 1246
49 Ga0466699_151707 3300042597 Bacteria 5008
50 JGI24698J34947_10008566 3300002449 Bacteria 5614
51 JGI24698J34947_10146376 3300002449 Bacteria 987
52 JGI24695J34938_10118804 3300002450 Bacteria 1076
53 Ga0072940_1161882 3300005200 Bacteria 1157
54 Ga0466712_137388 3300042614 Bacteria 1288
55 Ga0466712_141668 3300042614 Bacteria 1658
56 Ga0466715_392548 3300042616 Bacteria 2220
57 Ga0466718_078599 3300042617 Bacteria 26285
58 Ga0466719_100250 3300042606 Bacteria 17752
59 Ga0466720_190326 3300042607 Bacteria 21257
60 Ga0466704_218273 3300042643 Bacteria 27455
61 Ga0466704_548479 3300042643 Bacteria 4708
62 Ga0466709_036911 3300042648 Bacteria 6422
63 Ga0466708_198988 3300042652 Bacteria 7953
64 Ga0466691_106366 3300042593 Bacteria 1186
65 Ga0466699_008331 3300042597 Bacteria 2146
66 Ga0466699_130536 3300042597 Bacteria 13039
67 JGI24695J34938_10014192 3300002450 Bacteria 4143
68 JGI24695J34938_10032847 3300002450 Bacteria 2393
69 Ga0123356_10230010 3300010049 Bacteria 1918
70 Ga0466718_035678 3300042617 Bacteria 14749
71 Ga0466723_180663 3300042618 Bacteria 2047
72 Ga0466723_324585 3300042618 Unclassified 12873
73 Ga0466723_325742 3300042618 Bacteria 4140
74 Ga0466707_061761 3300042601 Bacteria 2775
75 Ga0466719_470517 3300042606 Bacteria 3128
76 Ga0466703_091197 3300042636 Bacteria 25667
77 Ga0466690_249769 3300042590 Bacteria 1836
78 Ga0466690_315726 3300042590 Unclassified 1260
79 Ga0466690_353936 3300042590 Bacteria 1551
80 Ga0466691_089239 3300042593 Bacteria 12278
81 Ga0466691_101256 3300042593 Bacteria 1691
82 Ga0466691_194184 3300042593 Bacteria 15293
83 Ga0466694_012820 3300042594 Bacteria 1194
84 JGI24698J34947_10041051 3300002449 Bacteria 2385
85 JGI24698J34947_10133815 3300002449 Bacteria 1055
86 JGI24695J34938_10000542 3300002450 Bacteria 36534
87 JGI24695J34938_10078761 3300002450 Bacteria 1364
88 JGI24702J35022_10056629 3300002462 Bacteria 2092
89 Ga0466705_183488 3300042612 Bacteria 2845
90 Ga0123353_10700683 3300010167 Bacteria 1421
91 Ga0466712_192498 3300042614 Bacteria 2637
92 Ga0466712_218160 3300042614 Bacteria 1796
93 Ga0466711_034799 3300042615 Bacteria 18162
94 Ga0466715_578998 3300042616 Bacteria 24023
95 Ga0466715_617902 3300042616 Bacteria 1076
96 Ga0466723_008861 3300042618 Bacteria 2447
97 Ga0466723_290689 3300042618 Bacteria 1479
98 Ga0466726_042769 3300042619 Bacteria 28047
99 Ga0466728_181523 3300042620 Bacteria 1856
100 Ga0466728_472700 3300042620 Bacteria 7189
101 Ga0466716_095086 3300042605 Bacteria 1464
102 Ga0466716_095612 3300042605 Bacteria 1283
103 Ga0466716_374332 3300042605 Bacteria 3862
104 Ga0466719_039887 3300042606 Bacteria 1218
105 Ga0466720_001847 3300042607 Bacteria 14739
106 Ga0466722_201439 3300042609 Bacteria 1139
107 Ga0466735_201612 3300042624 Bacteria 2103
108 Ga0466703_020216 3300042636 Bacteria 9558
109 Ga0466704_100975 3300042643 Bacteria 8177
110 Ga0466704_565861 3300042643 Bacteria 62930
111 Ga0466708_102740 3300042652 Bacteria 2295
112 Ga0466727_327507 3300042655 Bacteria 2730
113 Ga0264413_144380 3300024493 Bacteria 1557
114 Ga0456237_0007676 3300041968 Bacteria 1654
115 Ga0466691_003086 3300042593 Bacteria 3498
116 Ga0466699_151898 3300042597 Bacteria 4895
117 JGI24698J34947_10055616 3300002449 Unclassified 1970
118 JGI24698J34947_10058357 3300002449 Bacteria 1912
119 JGI24702J35022_10001839 3300002462 Bacteria 13071
120 Ga0466705_068195 3300042612 Bacteria 4062
121 Ga0466712_079188 3300042614 Unclassified 3846
122 Ga0466722_000511 3300042609 Bacteria 9118
123 Ga0466722_107027 3300042609 Bacteria 2796
124 Ga0466722_197656 3300042609 Bacteria 3202
125 Ga0466703_234873 3300042636 Bacteria 2239
126 Ga0466703_325863 3300042636 Bacteria 8217
127 Ga0466704_137190 3300042643 Bacteria 3796
128 Ga0466704_333824 3300042643 Bacteria 21099
129 Ga0466709_247826 3300042648 Bacteria 7622
130 Ga0466690_380375 3300042590 Bacteria 1606
131 Ga0466699_040916 3300042597 Bacteria 6428
132 JGI24698J34947_10087039 3300002449 Bacteria 1446
133 JGI24695J34938_10002900 3300002450 Bacteria 12463
134 Ga0072941_1054757 3300005201 Bacteria 5088
135 Ga0072941_1276854 3300005201 Bacteria 993
136 Ga0466705_061946 3300042612 Bacteria 1329
137 Ga0466712_024144 3300042614 Bacteria 2473
138 Ga0466712_074938 3300042614 Bacteria 1805
139 Ga0466712_097402 3300042614 Bacteria 1291
140 Ga0466715_395557 3300042616 Unclassified 6814
141 Ga0466715_424506 3300042616 Bacteria 10192
142 Ga0466715_427689 3300042616 Bacteria 1482
143 Ga0466723_052961 3300042618 Bacteria 34600
144 Ga0466726_183165 3300042619 Bacteria 1788
145 Ga0466728_071849 3300042620 Bacteria 3509
146 Ga0466707_090889 3300042601 Bacteria 3137
147 Ga0466707_174657 3300042601 Bacteria 1802
148 Ga0466716_331501 3300042605 Bacteria 9506
149 Ga0466722_181926 3300042609 Bacteria 13941
150 Ga0466735_055995 3300042624 Bacteria 5280
151 Ga0466709_067458 3300042648 Bacteria 2439
152 Ga0466690_068104 3300042590 Bacteria 7646
153 Ga0466699_233371 3300042597 Bacteria 3549
154 JGI24698J34947_10014171 3300002449 Bacteria 4341
155 JGI24698J34947_10029122 3300002449 Bacteria 2920
156 JGI24698J34947_10030467 3300002449 Bacteria 2844
157 JGI24695J34938_10045812 3300002450 Bacteria 1938
158 JGI24695J34938_10078975 3300002450 Bacteria 1362
159 JGI24702J35022_10008042 3300002462 Bacteria 6004
160 Ga0072940_1042237 3300005200 Bacteria 7994

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_480821 Ga0466715_480821_77_703 208
2 3300042652 Ga0466708_003759 Ga0466708_003759_23_649 208
3 3300042616 Ga0466715_207366 Ga0466715_207366_537_1232 219
4 3300024493 Ga0264413_144380 Ga0264413_1443802 226
5 3300042594 Ga0466694_012820 Ga0466694_012820_119_799 226
6 3300005201 Ga0072941_1276854 Ga0072941_12768542 229
7 3300042614 Ga0466712_110973 Ga0466712_110973_3715_4404 229
8 3300042614 Ga0466712_024144 Ga0466712_024144_1544_2239 231
9 3300042614 Ga0466712_074938 Ga0466712_074938_348_1043 231
10 3300042614 Ga0466712_218160 Ga0466712_218160_745_1440 231
11 3300042619 Ga0466726_042769 Ga0466726_042769_18547_19242 231
12 3300042655 Ga0466727_243860 Ga0466727_243860_9687_10382 231
13 3300002449 JGI24698J34947_10008345 JGI24698J34947_100083453 232
14 3300002449 JGI24698J34947_10008566 JGI24698J34947_100085663 232
15 3300002449 JGI24698J34947_10133815 JGI24698J34947_101338152 232
16 3300010167 Ga0123353_10700683 Ga0123353_107006832 232
17 3300042614 Ga0466712_073940 Ga0466712_073940_804_1502 232
18 3300002449 JGI24698J34947_10058357 JGI24698J34947_100583572 233
19 3300042614 Ga0466712_097402 Ga0466712_097402_107_808 233
20 3300002449 JGI24698J34947_10029122 JGI24698J34947_100291223 234
21 3300002449 JGI24698J34947_10030467 JGI24698J34947_100304672 234
22 3300002449 JGI24698J34947_10055616 JGI24698J34947_100556162 234
23 3300002449 JGI24698J34947_10146376 JGI24698J34947_101463762 234
24 3300002449 JGI24698J34947_10092234 JGI24698J34947_100922342 235
25 3300042590 Ga0466690_068104 Ga0466690_068104_2462_3169 235
26 3300042593 Ga0466691_089239 Ga0466691_089239_10416_11123 235
27 3300042605 Ga0466716_352671 Ga0466716_352671_1523_2230 235
28 3300042614 Ga0466712_079188 Ga0466712_079188_2852_3559 235
29 3300042614 Ga0466712_312622 Ga0466712_312622_2080_2787 235
30 3300042617 Ga0466718_035678 Ga0466718_035678_8644_9390 235
31 3300042620 Ga0466728_472700 Ga0466728_472700_1320_2027 235
32 3300042648 Ga0466709_172904 Ga0466709_172904_7107_7814 235
33 3300002449 JGI24698J34947_10041051 JGI24698J34947_100410512 236
34 3300002449 JGI24698J34947_10084790 JGI24698J34947_100847902 236
35 3300002449 JGI24698J34947_10087039 JGI24698J34947_100870392 236
36 3300042652 Ga0466708_102740 Ga0466708_102740_1406_2116 236
37 3300005200 Ga0072940_1042237 Ga0072940_10422379 237
38 3300005201 Ga0072941_1054757 Ga0072941_10547575 237
39 3300042607 Ga0466720_001847 Ga0466720_001847_1423_2136 237
40 3300042617 Ga0466718_078599 Ga0466718_078599_11073_11786 237
41 3300002449 JGI24698J34947_10014171 JGI24698J34947_100141713 238
42 3300042607 Ga0466720_190326 Ga0466720_190326_14745_15464 239
43 3300042614 Ga0466712_137388 Ga0466712_137388_294_1013 239
44 3300042614 Ga0466712_141668 Ga0466712_141668_25_744 239
45 3300042618 Ga0466723_052961 Ga0466723_052961_14922_15641 239
46 iso_pr_bacteria 2781125695 2781438579 239
47 3300002449 JGI24698J34947_10011756 JGI24698J34947_100117563 240
48 3300002462 JGI24702J35022_10008042 JGI24702J35022_100080423 240
49 3300005200 Ga0072940_1161882 Ga0072940_11618821 240
50 3300042612 Ga0466705_204736 Ga0466705_204736_14397_15119 240
51 3300042636 Ga0466703_020216 Ga0466703_020216_7496_8218 240
52 3300042643 Ga0466704_140988 Ga0466704_140988_3027_3749 240
53 3300042594 Ga0466694_201000 Ga0466694_201000_308_1033 241
54 3300042597 Ga0466699_040916 Ga0466699_040916_1121_1846 241
55 3300042597 Ga0466699_130536 Ga0466699_130536_3285_4010 241
56 3300042597 Ga0466699_151898 Ga0466699_151898_909_1634 241
57 3300042610 Ga0466698_114127 Ga0466698_114127_698_1423 241
58 3300042615 Ga0466711_247962 Ga0466711_247962_236_1015 241
59 3300002450 JGI24695J34938_10118804 JGI24695J34938_101188041 242
60 3300042597 Ga0466699_108387 Ga0466699_108387_7762_8490 242
61 3300042597 Ga0466699_151707 Ga0466699_151707_3282_4010 242
62 3300042597 Ga0466699_233371 Ga0466699_233371_144_872 242
63 3300042605 Ga0466716_095086 Ga0466716_095086_269_997 242
64 3300042605 Ga0466716_095612 Ga0466716_095612_287_1015 242
65 3300042609 Ga0466722_000578 Ga0466722_000578_1607_2335 242
66 3300042612 Ga0466705_153285 Ga0466705_153285_5677_6405 242
67 3300042614 Ga0466712_192498 Ga0466712_192498_1275_2003 242
68 3300042616 Ga0466715_424506 Ga0466715_424506_2349_3077 242
69 3300042636 Ga0466703_009073 Ga0466703_009073_1246_1974 242
70 3300042643 Ga0466704_548479 Ga0466704_548479_28_756 242
71 3300002450 JGI24695J34938_10014192 JGI24695J34938_100141923 243
72 3300002450 JGI24695J34938_10045812 JGI24695J34938_100458122 243
73 3300005201 Ga0072941_1115775 Ga0072941_11157753 243
74 3300041968 Ga0456237_0007676 Ga0456237_0007676_222_953 243
75 3300042601 Ga0466707_061761 Ga0466707_061761_2032_2763 243
76 3300042609 Ga0466722_181926 Ga0466722_181926_8134_8865 243
77 3300042615 Ga0466711_034799 Ga0466711_034799_14780_15511 243
78 3300042618 Ga0466723_180663 Ga0466723_180663_735_1466 243
79 3300000089 AustNasuHG_c1015036 AustNasuHG_10150363 244
80 3300042590 Ga0466690_217407 Ga0466690_217407_264_998 244
81 3300042590 Ga0466690_315726 Ga0466690_315726_278_1012 244
82 3300042590 Ga0466690_380375 Ga0466690_380375_133_867 244
83 3300042593 Ga0466691_003086 Ga0466691_003086_878_1612 244
84 3300042593 Ga0466691_013250 Ga0466691_013250_669_1403 244
85 3300042593 Ga0466691_101256 Ga0466691_101256_132_866 244
86 3300042593 Ga0466691_129261 Ga0466691_129261_314_1048 244
87 3300042593 Ga0466691_194184 Ga0466691_194184_2604_3338 244
88 3300042596 Ga0466696_324431 Ga0466696_324431_244_978 244
89 3300042597 Ga0466699_008331 Ga0466699_008331_1088_1822 244
90 3300042601 Ga0466707_174657 Ga0466707_174657_943_1677 244
91 3300042605 Ga0466716_331501 Ga0466716_331501_2428_3162 244
92 3300042606 Ga0466719_039887 Ga0466719_039887_403_1137 244
93 3300042606 Ga0466719_079168 Ga0466719_079168_630_1364 244
94 3300042606 Ga0466719_470517 Ga0466719_470517_2195_2929 244
95 3300042609 Ga0466722_000511 Ga0466722_000511_6764_7498 244
96 3300042609 Ga0466722_197656 Ga0466722_197656_2014_2748 244
97 3300042609 Ga0466722_201439 Ga0466722_201439_189_923 244
98 3300042612 Ga0466705_061946 Ga0466705_061946_60_794 244
99 3300042612 Ga0466705_068195 Ga0466705_068195_374_1108 244
100 3300042612 Ga0466705_131799 Ga0466705_131799_452_1186 244
101 3300042616 Ga0466715_395557 Ga0466715_395557_1799_2533 244
102 3300042616 Ga0466715_551351 Ga0466715_551351_1654_2388 244
103 3300042618 Ga0466723_008861 Ga0466723_008861_176_910 244
104 3300042618 Ga0466723_324585 Ga0466723_324585_9975_10709 244
105 3300042620 Ga0466728_071849 Ga0466728_071849_777_1511 244
106 3300042620 Ga0466728_126782 Ga0466728_126782_868_1602 244
107 3300042620 Ga0466728_181523 Ga0466728_181523_743_1477 244
108 3300042624 Ga0466735_151264 Ga0466735_151264_1831_2565 244
109 3300042624 Ga0466735_201612 Ga0466735_201612_93_827 244
110 3300042636 Ga0466703_212476 Ga0466703_212476_241_975 244
111 3300042636 Ga0466703_234873 Ga0466703_234873_942_1676 244
112 3300042636 Ga0466703_325863 Ga0466703_325863_6918_7652 244
113 3300042643 Ga0466704_100975 Ga0466704_100975_3205_3939 244
114 3300042648 Ga0466709_067458 Ga0466709_067458_291_1025 244
115 3300042652 Ga0466708_020351 Ga0466708_020351_17865_18599 244
116 3300042652 Ga0466708_198988 Ga0466708_198988_3569_4303 244
117 3300010167 Ga0123353_11438662 Ga0123353_114386621 245
118 3300042601 Ga0466707_090889 Ga0466707_090889_577_1314 245
119 3300042609 Ga0466722_107027 Ga0466722_107027_632_1369 245
120 3300042612 Ga0466705_183488 Ga0466705_183488_1850_2587 245
121 3300042618 Ga0466723_218601 Ga0466723_218601_229_966 245
122 3300042643 Ga0466704_137190 Ga0466704_137190_1742_2479 245
123 iso_pr_bacteria 2781125631 2781268224 245
124 3300042612 Ga0466705_013726 Ga0466705_013726_24354_25094 246
125 3300042643 Ga0466704_333824 Ga0466704_333824_9960_10700 246
126 3300042643 Ga0466704_565861 Ga0466704_565861_9864_10604 246
127 3300002450 JGI24695J34938_10032847 JGI24695J34938_100328472 247
128 3300010049 Ga0123356_10230010 Ga0123356_102300102 247
129 3300042593 Ga0466691_106366 Ga0466691_106366_350_1135 247
130 3300042596 Ga0466696_435701 Ga0466696_435701_1780_2523 247
131 3300042615 Ga0466711_011556 Ga0466711_011556_2996_3739 247
132 3300042616 Ga0466715_392548 Ga0466715_392548_197_940 247
133 3300042616 Ga0466715_617902 Ga0466715_617902_235_978 247
134 3300042618 Ga0466723_290689 Ga0466723_290689_99_842 247
135 iso_pr_bacteria 2781125640 2781288674 247
136 3300002450 JGI24695J34938_10002900 JGI24695J34938_100029003 248
137 3300002450 JGI24695J34938_10014535 JGI24695J34938_100145353 248
138 3300002450 JGI24695J34938_10078761 JGI24695J34938_100787612 248
139 3300002450 JGI24695J34938_10078975 JGI24695J34938_100789751 248
140 3300042590 Ga0466690_249769 Ga0466690_249769_698_1444 248
141 3300042618 Ga0466723_340980 Ga0466723_340980_1683_2435 250
142 3300042636 Ga0466703_306142 Ga0466703_306142_2499_3251 250
143 3300002462 JGI24702J35022_10001839 JGI24702J35022_100018398 251
144 3300002462 JGI24702J35022_10056629 JGI24702J35022_100566292 251
145 3300042605 Ga0466716_485148 Ga0466716_485148_742_1497 251
146 3300042606 Ga0466719_100250 Ga0466719_100250_16374_17129 251
147 3300042618 Ga0466723_325742 Ga0466723_325742_3357_4112 251
148 3300042624 Ga0466735_055995 Ga0466735_055995_219_974 251
149 iso_pr_bacteria 2781125633 2781272433 251
150 3300002450 JGI24695J34938_10000542 JGI24695J34938_1000054231 252
151 3300042590 Ga0466690_353936 Ga0466690_353936_416_1174 252
152 3300042605 Ga0466716_374332 Ga0466716_374332_198_956 252
153 3300042616 Ga0466715_427689 Ga0466715_427689_691_1449 252
154 3300042619 Ga0466726_183165 Ga0466726_183165_260_1018 252
155 3300042648 Ga0466709_036911 Ga0466709_036911_5134_5892 252
156 3300042652 Ga0466708_040913 Ga0466708_040913_3810_4568 252
157 3300042591 Ga0466692_194237 Ga0466692_194237_61_822 253
158 3300042636 Ga0466703_091197 Ga0466703_091197_13385_14146 253
159 3300042616 Ga0466715_160435 Ga0466715_160435_3495_4268 257
160 3300042636 Ga0466703_157107 Ga0466703_157107_10952_11746 258
161 3300042655 Ga0466727_327507 Ga0466727_327507_156_932 258
162 3300042648 Ga0466709_247826 Ga0466709_247826_2295_3080 261
163 3300042616 Ga0466715_578998 Ga0466715_578998_12284_13075 263
164 3300042643 Ga0466704_218273 Ga0466704_218273_10724_11536 270

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.