Protein Family IF09419

Metagenome Isolate
203 Members
60 Samples
193 Scaffolds
252.82 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_202245|Ga0466704_202245_14987_15835
Length
282 aa
Sequence
VNYKPNQARPALAPAGRTRVPPNPGQAVNVVRIPQIIRTEKLSKAFGANAVLKEVTLGIPEKKVSAVIGQSGTGKSVLFKTIMGMMKPDQGRVWFRDIELTAIKRSELIAMRRHFGYSFQNAALFDSMTVGENLAFPLREVLRIKDRGKIRRSVAEMLEWIELPGIESKRPDELSGGMRKRVGVARALIMQPEVLFFDEPTTGLDPVLSETINNLVVRVNRELHITCVMITHDIPAAFRIADKIAFLDQGYIIAEGSPREVVSSKHTMVRDFLRISFNELKV

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.1%
Kalotermitidae 25.9%
Unclassified 17.2%
Termopsidae 6.9%
Rhinotermitidae 5.2%
Blaberidae 1.7%

🌳 Taxonomy

Archaea 1
Bacteria 197
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
12 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
26 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2772190975 Treponema sp. RmG30 Isolate Blaberidae
41 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
46 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
51 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
52 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
53 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
56 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
57 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
58 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
59 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
60 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_021493 3300042612 Bacteria 14502
2 Ga0466705_064507 3300042612 Bacteria 9210
3 Ga0466705_375020 3300042612 Bacteria 5278
4 Ga0466707_377050 3300042601 Bacteria 1211
5 Ga0466719_233511 3300042606 Bacteria 5353
6 Ga0466712_148632 3300042614 Bacteria 1797
7 Ga0466711_111753 3300042615 Bacteria 4822
8 Ga0466711_192109 3300042615 Bacteria 2790
9 Ga0466711_283817 3300042615 Bacteria 5209
10 Ga0466718_084942 3300042617 Bacteria 1515
11 Ga0466723_269484 3300042618 Bacteria 3182
12 Ga0466723_288045 3300042618 Unclassified 3998
13 Ga0466729_050171 3300042621 Bacteria 2764
14 Ga0466704_222603 3300042643 Bacteria 60546
15 Ga0466704_293402 3300042643 Bacteria 1675
16 Ga0466709_127358 3300042648 Bacteria 18279
17 Ga0466709_147740 3300042648 Bacteria 5306
18 Ga0466708_039521 3300042652 Bacteria 3832
19 Ga0466708_461551 3300042652 Bacteria 1704
20 Ga0415639_127551 3300038395 Bacteria 3845
21 Ga0466690_006391 3300042590 Bacteria 4056
22 Ga0123356_10002407 3300010049 Bacteria 20024
23 Ga0123356_10003429 3300010049 Bacteria 16603
24 Ga0123354_10193024 3300010882 Bacteria 2271
25 JGI24695J34938_10001833 3300002450 Bacteria 17337
26 Ga0466732_214169 3300042656 Bacteria 2564
27 Ga0466719_386768 3300042606 Bacteria 5527
28 Ga0466719_428429 3300042606 Bacteria 8712
29 Ga0466719_549108 3300042606 Unclassified 1631
30 Ga0466711_037118 3300042615 Bacteria 3034
31 Ga0466711_340444 3300042615 Bacteria 1591
32 Ga0466715_266169 3300042616 Bacteria 1026
33 Ga0466715_465901 3300042616 Bacteria 11392
34 Ga0466715_517254 3300042616 Bacteria 19210
35 Ga0466726_304465 3300042619 Bacteria 3622
36 Ga0466703_082349 3300042636 Bacteria 4466
37 Ga0466704_045761 3300042643 Bacteria 13519
38 Ga0466704_237358 3300042643 Bacteria 7896
39 Ga0466704_491861 3300042643 Bacteria 1002
40 Ga0466709_140045 3300042648 Bacteria 12847
41 Ga0466708_069200 3300042652 Bacteria 7285
42 Ga0466708_111845 3300042652 Bacteria 5982
43 Ga0466708_148083 3300042652 Bacteria 6634
44 Ga0415639_117648 3300038395 Bacteria 5591
45 Ga0466691_160224 3300042593 Bacteria 27887
46 Ga0466694_139082 3300042594 Bacteria 5706
47 Ga0466694_198102 3300042594 Bacteria 3618
48 Ga0466694_284393 3300042594 Bacteria 8040
49 Ga0072941_1028231 3300005201 Bacteria 7379
50 Ga0466717_077938 3300042604 Bacteria 1547
51 Ga0466716_028709 3300042605 Bacteria 1253
52 Ga0466716_186547 3300042605 Bacteria 1257
53 Ga0466715_603655 3300042616 Bacteria 10375
54 Ga0466718_076023 3300042617 Bacteria 19549
55 Ga0466723_064254 3300042618 Bacteria 3007
56 Ga0466723_196407 3300042618 Bacteria 1635
57 Ga0466723_365336 3300042618 Bacteria 6225
58 Ga0466728_231640 3300042620 Bacteria 9106
59 Ga0466728_460005 3300042620 Bacteria 5101
60 Ga0466728_479190 3300042620 Bacteria 5459
61 Ga0466704_140302 3300042643 Bacteria 3256
62 Ga0466709_193696 3300042648 Bacteria 3024
63 Ga0466708_285050 3300042652 Bacteria 48734
64 Ga0466708_419574 3300042652 Bacteria 2156
65 Ga0466727_290440 3300042655 Bacteria 1259
66 Ga0415639_022751 3300038395 Bacteria 7862
67 Ga0466657_101067 3300042582 Bacteria 1007
68 Ga0466690_041598 3300042590 Bacteria 2052
69 Ga0466691_036978 3300042593 Bacteria 4260
70 Ga0466696_300246 3300042596 Bacteria 7689
71 Ga0123356_10003416 3300010049 Bacteria 16639
72 JGI24698J34947_10040571 3300002449 Bacteria 2402
73 JGI24695J34938_10018401 3300002450 Bacteria 3493
74 Ga0466705_237477 3300042612 Bacteria 4397
75 Ga0466716_193208 3300042605 Bacteria 2745
76 Ga0466716_467705 3300042605 Bacteria 8879
77 Ga0466719_204308 3300042606 Bacteria 18675
78 Ga0466711_185972 3300042615 Bacteria 1479
79 Ga0466723_018641 3300042618 Bacteria 57830
80 Ga0466723_030944 3300042618 Bacteria 8107
81 Ga0466728_249752 3300042620 Bacteria 11343
82 Ga0466703_083490 3300042636 Bacteria 11560
83 Ga0466704_054474 3300042643 Bacteria 6087
84 Ga0466704_068798 3300042643 Bacteria 3237
85 Ga0466704_202245 3300042643 Bacteria 62547
86 Ga0466708_120110 3300042652 Bacteria 21676
87 Ga0466708_221722 3300042652 Bacteria 4437
88 Ga0466727_226308 3300042655 Bacteria 1558
89 Ga0415639_042917 3300038395 Bacteria 4591
90 Ga0466690_067040 3300042590 Bacteria 5015
91 Ga0466692_068566 3300042591 Bacteria 34048
92 Ga0466695_282155 3300042595 Bacteria 9918
93 Ga0466695_287167 3300042595 Bacteria 1651
94 Ga0466696_163279 3300042596 Archaea 4437
95 Ga0466696_407706 3300042596 Bacteria 1588
96 Ga0123353_10583603 3300010167 Bacteria 1603
97 Ga0123353_10746629 3300010167 Bacteria 1363
98 Ga0123354_10226964 3300010882 Bacteria 1965
99 JGI24695J34938_10062804 3300002450 Bacteria 1576
100 Ga0072940_1027168 3300005200 Bacteria 4434
101 Ga0072941_1105486 3300005201 Bacteria 3715
102 Ga0072941_1161323 3300005201 Bacteria 2223
103 Ga0105524_100227 3300007733 Bacteria 12639
104 Ga0466705_223816 3300042612 Bacteria 2543
105 Ga0466705_257279 3300042612 Bacteria 4517
106 Ga0466705_369611 3300042612 Bacteria 5074
107 Ga0466700_295982 3300042600 Bacteria 1358
108 Ga0466707_213830 3300042601 Bacteria 8802
109 Ga0466719_035255 3300042606 Unclassified 1493
110 Ga0466719_479880 3300042606 Bacteria 1837
111 Ga0466697_045139 3300042611 Bacteria 12760
112 Ga0466715_065180 3300042616 Bacteria 5080
113 Ga0466703_143749 3300042636 Bacteria 3999
114 Ga0466703_188679 3300042636 Bacteria 4037
115 Ga0466703_239168 3300042636 Bacteria 18053
116 Ga0466709_027018 3300042648 Bacteria 5707
117 Ga0466708_304447 3300042652 Bacteria 6402
118 Ga0466691_188503 3300042593 Bacteria 2430
119 Ga0466696_144821 3300042596 Bacteria 24072
120 JGI24696J40584_12943262 3300002834 Bacteria 1768
121 Ga0068302_10556082 3300005071 Bacteria 904
122 Ga0466705_049651 3300042612 Bacteria 6787
123 Ga0466705_102688 3300042612 Bacteria 17173
124 Ga0466705_181525 3300042612 Bacteria 22609
125 Ga0466732_336543 3300042656 Bacteria 4764
126 Ga0466701_075709 3300042598 Bacteria 2163
127 Ga0466713_045396 3300042602 Bacteria 1458
128 Ga0466722_059803 3300042609 Bacteria 24916
129 Ga0466711_250812 3300042615 Bacteria 11619
130 Ga0466715_010756 3300042616 Bacteria 11031
131 Ga0466715_124780 3300042616 Bacteria 3761
132 Ga0466715_128970 3300042616 Bacteria 7256
133 Ga0466715_321429 3300042616 Bacteria 8691
134 Ga0466728_207263 3300042620 Bacteria 13163
135 Ga0466731_380565 3300042622 Bacteria 2919
136 Ga0466735_188562 3300042624 Bacteria 3711
137 Ga0466703_360992 3300042636 Bacteria 10288
138 Ga0466703_389215 3300042636 Bacteria 42403
139 Ga0466704_247867 3300042643 Bacteria 8426
140 Ga0466704_612927 3300042643 Bacteria 2733
141 Ga0466709_053653 3300042648 Bacteria 1588
142 Ga0466690_080350 3300042590 Bacteria 2055
143 Ga0466694_178229 3300042594 Bacteria 4317
144 Ga0466695_290770 3300042595 Bacteria 97007
145 Ga0123355_10070048 3300009826 Bacteria 5634
146 AustNasuHG_c1005130 3300000089 Bacteria 4684
147 JGI24702J35022_10009842 3300002462 Bacteria 5358
148 Ga0466705_027668 3300042612 Unclassified 1280
149 Ga0466705_067513 3300042612 Bacteria 4785
150 Ga0466705_301735 3300042612 Bacteria 4620
151 Ga0466707_222392 3300042601 Bacteria 12258
152 Ga0466716_020160 3300042605 Bacteria 2048
153 Ga0466716_415469 3300042605 Bacteria 5321
154 Ga0466719_070401 3300042606 Bacteria 7337
155 Ga0466719_297120 3300042606 Bacteria 1142
156 Ga0466705_484739 3300042612 Bacteria 6747
157 Ga0466711_300254 3300042615 Bacteria 7469
158 Ga0466715_110720 3300042616 Bacteria 1749
159 Ga0466731_156783 3300042622 Bacteria 1205
160 Ga0466704_160094 3300042643 Bacteria 11396
161 Ga0466709_124918 3300042648 Bacteria 1946
162 Ga0466708_171467 3300042652 Bacteria 2552
163 Ga0466708_283097 3300042652 Bacteria 4990
164 Ga0466692_158534 3300042591 Bacteria 8572
165 Ga0466692_172451 3300042591 Bacteria 2037
166 Ga0466693_223695 3300042592 Bacteria 1057
167 Ga0466695_063257 3300042595 Bacteria 1560
168 Ga0466696_053241 3300042596 Bacteria 7332
169 Ga0466699_053303 3300042597 Bacteria 6618
170 Ga0123356_10010005 3300010049 Bacteria 9333
171 Ga0123354_10398762 3300010882 Bacteria 1167
172 Ga0466705_081280 3300042612 Bacteria 4170
173 Ga0466719_024324 3300042606 Bacteria 1968
174 Ga0466722_088142 3300042609 Bacteria 11867
175 Ga0466722_106727 3300042609 Bacteria 11506
176 Ga0466722_168945 3300042609 Bacteria 1730
177 Ga0466712_134669 3300042614 Bacteria 13333
178 Ga0466711_312387 3300042615 Bacteria 16329
179 Ga0466723_271952 3300042618 Bacteria 4843
180 Ga0466729_163170 3300042621 Bacteria 207322
181 Ga0466735_009175 3300042624 Bacteria 2365
182 Ga0466704_284658 3300042643 Unclassified 3784
183 Ga0466708_101543 3300042652 Bacteria 4098
184 Ga0466727_182967 3300042655 Bacteria 3078
185 Ga0466690_192590 3300042590 Bacteria 8966
186 Ga0466694_346577 3300042594 Bacteria 1668
187 Ga0466699_078583 3300042597 Bacteria 1081
188 Ga0123355_10099713 3300009826 Bacteria 4577
189 Ga0123355_10213793 3300009826 Bacteria 2788
190 Ga0123353_10046810 3300010167 Bacteria 6877
191 Ga0123353_10069907 3300010167 Bacteria 5640
192 Ga0072941_1161324 3300005201 Bacteria 2192
193 Ga0123357_10000033 3300009784 Bacteria 113776

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_491861 Ga0466704_491861_21_707 228
2 3300038395 Ga0415639_117648 Ga0415639_117648_713_1402 229
3 3300042590 Ga0466690_006391 Ga0466690_006391_1635_2330 231
4 3300042620 Ga0466728_460005 Ga0466728_460005_1739_2434 231
5 3300042655 Ga0466727_226308 Ga0466727_226308_824_1519 231
6 3300042592 Ga0466693_223695 Ga0466693_223695_78_863 232
7 3300042652 Ga0466708_069200 Ga0466708_069200_3578_4276 232
8 3300002450 JGI24695J34938_10062804 JGI24695J34938_100628042 239
9 3300042595 Ga0466695_282155 Ga0466695_282155_5441_6226 244
10 3300042618 Ga0466723_271952 Ga0466723_271952_2413_3228 246
11 3300042652 Ga0466708_101543 Ga0466708_101543_2077_2817 246
12 3300009826 Ga0123355_10070048 Ga0123355_100700483 247
13 iso_pr_bacteria 651324002 651580270 247
14 3300042605 Ga0466716_020160 Ga0466716_020160_698_1444 248
15 3300042612 Ga0466705_027668 Ga0466705_027668_187_933 248
16 3300042652 Ga0466708_039521 Ga0466708_039521_1806_2552 248
17 3300042652 Ga0466708_148083 Ga0466708_148083_951_1697 248
18 3300010882 Ga0123354_10226964 Ga0123354_102269642 249
19 3300042605 Ga0466716_415469 Ga0466716_415469_2639_3388 249
20 3300042606 Ga0466719_479880 Ga0466719_479880_849_1598 249
21 3300042652 Ga0466708_120110 Ga0466708_120110_5560_6309 249
22 3300042590 Ga0466690_041598 Ga0466690_041598_21_773 250
23 3300042590 Ga0466690_080350 Ga0466690_080350_518_1270 250
24 3300042591 Ga0466692_068566 Ga0466692_068566_6274_7026 250
25 3300042591 Ga0466692_172451 Ga0466692_172451_217_969 250
26 3300042593 Ga0466691_188503 Ga0466691_188503_780_1532 250
27 3300042594 Ga0466694_178229 Ga0466694_178229_2007_2759 250
28 3300042596 Ga0466696_144821 Ga0466696_144821_22554_23306 250
29 3300042596 Ga0466696_163279 Ga0466696_163279_1900_2652 250
30 3300042601 Ga0466707_222392 Ga0466707_222392_1815_2567 250
31 3300042605 Ga0466716_193208 Ga0466716_193208_1007_1759 250
32 3300042606 Ga0466719_204308 Ga0466719_204308_2835_3587 250
33 3300042606 Ga0466719_233511 Ga0466719_233511_3819_4571 250
34 3300042606 Ga0466719_549108 Ga0466719_549108_66_818 250
35 3300042609 Ga0466722_106727 Ga0466722_106727_5933_6685 250
36 3300042609 Ga0466722_168945 Ga0466722_168945_710_1462 250
37 3300042612 Ga0466705_067513 Ga0466705_067513_3113_3865 250
38 3300042612 Ga0466705_102688 Ga0466705_102688_13169_13921 250
39 3300042612 Ga0466705_237477 Ga0466705_237477_902_1654 250
40 3300042612 Ga0466705_369611 Ga0466705_369611_2074_2826 250
41 3300042612 Ga0466705_375020 Ga0466705_375020_831_1583 250
42 3300042615 Ga0466711_111753 Ga0466711_111753_2203_2955 250
43 3300042615 Ga0466711_185972 Ga0466711_185972_423_1175 250
44 3300042615 Ga0466711_250812 Ga0466711_250812_4017_4769 250
45 3300042615 Ga0466711_283817 Ga0466711_283817_3132_3884 250
46 3300042615 Ga0466711_312387 Ga0466711_312387_5140_5892 250
47 3300042615 Ga0466711_340444 Ga0466711_340444_649_1401 250
48 3300042616 Ga0466715_110720 Ga0466715_110720_143_895 250
49 3300042616 Ga0466715_266169 Ga0466715_266169_93_845 250
50 3300042616 Ga0466715_465901 Ga0466715_465901_4455_5207 250
51 3300042616 Ga0466715_603655 Ga0466715_603655_4582_5334 250
52 3300042617 Ga0466718_076023 Ga0466718_076023_4708_5460 250
53 3300042617 Ga0466718_084942 Ga0466718_084942_155_907 250
54 3300042618 Ga0466723_018641 Ga0466723_018641_43228_43980 250
55 3300042618 Ga0466723_030944 Ga0466723_030944_1073_1825 250
56 3300042618 Ga0466723_064254 Ga0466723_064254_907_1659 250
57 3300042618 Ga0466723_269484 Ga0466723_269484_96_848 250
58 3300042618 Ga0466723_288045 Ga0466723_288045_1603_2355 250
59 3300042618 Ga0466723_365336 Ga0466723_365336_5346_6098 250
60 3300042620 Ga0466728_207263 Ga0466728_207263_6422_7174 250
61 3300042620 Ga0466728_249752 Ga0466728_249752_9809_10561 250
62 3300042621 Ga0466729_050171 Ga0466729_050171_448_1200 250
63 3300042622 Ga0466731_380565 Ga0466731_380565_55_807 250
64 3300042624 Ga0466735_009175 Ga0466735_009175_228_980 250
65 3300042624 Ga0466735_188562 Ga0466735_188562_961_1713 250
66 3300042636 Ga0466703_083490 Ga0466703_083490_1007_1759 250
67 3300042636 Ga0466703_360992 Ga0466703_360992_1621_2373 250
68 3300042643 Ga0466704_054474 Ga0466704_054474_2501_3253 250
69 3300042643 Ga0466704_068798 Ga0466704_068798_1185_1937 250
70 3300042643 Ga0466704_237358 Ga0466704_237358_2460_3212 250
71 3300042643 Ga0466704_284658 Ga0466704_284658_1660_2412 250
72 3300042648 Ga0466709_124918 Ga0466709_124918_920_1672 250
73 3300042648 Ga0466709_127358 Ga0466709_127358_2296_3048 250
74 3300042648 Ga0466709_147740 Ga0466709_147740_1396_2148 250
75 3300042648 Ga0466709_193696 Ga0466709_193696_1047_1799 250
76 3300042652 Ga0466708_171467 Ga0466708_171467_1471_2223 250
77 3300042652 Ga0466708_221722 Ga0466708_221722_1605_2357 250
78 3300042652 Ga0466708_285050 Ga0466708_285050_22753_23505 250
79 3300042652 Ga0466708_304447 Ga0466708_304447_821_1573 250
80 3300042652 Ga0466708_419574 Ga0466708_419574_958_1710 250
81 3300042655 Ga0466727_182967 Ga0466727_182967_865_1617 250
82 3300042655 Ga0466727_290440 Ga0466727_290440_490_1242 250
83 3300042656 Ga0466732_214169 Ga0466732_214169_1030_1782 250
84 3300042656 Ga0466732_336543 Ga0466732_336543_1981_2733 250
85 iso_pr_bacteria 2781125664 2781340181 250
86 iso_pr_bacteria 2781125692 2781431381 250
87 3300010049 Ga0123356_10003416 Ga0123356_1000341613 251
88 3300010049 Ga0123356_10010005 Ga0123356_100100057 251
89 3300042594 Ga0466694_284393 Ga0466694_284393_5100_5855 251
90 3300042596 Ga0466696_300246 Ga0466696_300246_1310_2065 251
91 3300042601 Ga0466707_377050 Ga0466707_377050_378_1133 251
92 3300042604 Ga0466717_077938 Ga0466717_077938_378_1133 251
93 3300042605 Ga0466716_467705 Ga0466716_467705_3384_4139 251
94 3300042606 Ga0466719_070401 Ga0466719_070401_1777_2532 251
95 3300042606 Ga0466719_428429 Ga0466719_428429_1770_2525 251
96 3300042612 Ga0466705_049651 Ga0466705_049651_702_1457 251
97 3300042612 Ga0466705_484739 Ga0466705_484739_523_1278 251
98 3300042620 Ga0466728_231640 Ga0466728_231640_2472_3227 251
99 3300042636 Ga0466703_188679 Ga0466703_188679_1990_2745 251
100 3300042636 Ga0466703_389215 Ga0466703_389215_11411_12166 251
101 3300042643 Ga0466704_140302 Ga0466704_140302_1127_1882 251
102 3300042643 Ga0466704_247867 Ga0466704_247867_1146_1901 251
103 iso_pr_bacteria 2781125629 2781263165 251
104 iso_pr_bacteria 2781125630 2781265828 251
105 iso_pr_bacteria 2781125631 2781268884 251
106 3300038395 Ga0415639_022751 Ga0415639_022751_5715_6473 252
107 3300038395 Ga0415639_042917 Ga0415639_042917_821_1579 252
108 3300038395 Ga0415639_127551 Ga0415639_127551_2246_3004 252
109 3300042582 Ga0466657_101067 Ga0466657_101067_203_961 252
110 3300042595 Ga0466695_290770 Ga0466695_290770_79297_80055 252
111 3300042596 Ga0466696_407706 Ga0466696_407706_141_899 252
112 3300042606 Ga0466719_024324 Ga0466719_024324_473_1231 252
113 3300042609 Ga0466722_059803 Ga0466722_059803_18818_19576 252
114 3300042612 Ga0466705_021493 Ga0466705_021493_5258_6016 252
115 3300042614 Ga0466712_134669 Ga0466712_134669_8349_9107 252
116 3300042622 Ga0466731_156783 Ga0466731_156783_46_804 252
117 3300042636 Ga0466703_082349 Ga0466703_082349_2738_3496 252
118 3300042636 Ga0466703_239168 Ga0466703_239168_12531_13289 252
119 3300042648 Ga0466709_027018 Ga0466709_027018_2256_3014 252
120 3300042652 Ga0466708_283097 Ga0466708_283097_2731_3489 252
121 3300002449 JGI24698J34947_10040571 JGI24698J34947_100405712 253
122 3300002450 JGI24695J34938_10018401 JGI24695J34938_100184014 253
123 3300002834 JGI24696J40584_12943262 JGI24696J40584_129432622 253
124 3300005201 Ga0072941_1028231 Ga0072941_10282313 253
125 3300005201 Ga0072941_1105486 Ga0072941_11054864 253
126 3300005201 Ga0072941_1161323 Ga0072941_11613232 253
127 3300005201 Ga0072941_1161324 Ga0072941_11613242 253
128 3300010049 Ga0123356_10002407 Ga0123356_100024079 253
129 3300010049 Ga0123356_10003429 Ga0123356_100034298 253
130 3300010167 Ga0123353_10069907 Ga0123353_100699072 253
131 3300010167 Ga0123353_10583603 Ga0123353_105836032 253
132 3300042590 Ga0466690_192590 Ga0466690_192590_1544_2305 253
133 3300042600 Ga0466700_295982 Ga0466700_295982_248_1009 253
134 3300042601 Ga0466707_213830 Ga0466707_213830_4368_5129 253
135 3300042606 Ga0466719_386768 Ga0466719_386768_3348_4109 253
136 3300042612 Ga0466705_064507 Ga0466705_064507_1568_2329 253
137 3300042614 Ga0466712_148632 Ga0466712_148632_391_1152 253
138 3300042616 Ga0466715_517254 Ga0466715_517254_13513_14274 253
139 3300042620 Ga0466728_479190 Ga0466728_479190_2769_3530 253
140 3300042648 Ga0466709_053653 Ga0466709_053653_188_949 253
141 iso_pr_bacteria 2772190975 2773721053 253
142 3300002450 JGI24695J34938_10001833 JGI24695J34938_100018336 254
143 3300005071 Ga0068302_10556082 Ga0068302_105560821 254
144 3300010167 Ga0123353_10046810 Ga0123353_100468105 254
145 3300010882 Ga0123354_10193024 Ga0123354_101930243 254
146 3300042594 Ga0466694_198102 Ga0466694_198102_1535_2299 254
147 3300042605 Ga0466716_186547 Ga0466716_186547_123_887 254
148 iso_pr_bacteria 2781125653 2781313601 254
149 3300000089 AustNasuHG_c1005130 AustNasuHG_10051302 255
150 3300005200 Ga0072940_1027168 Ga0072940_10271683 255
151 3300042594 Ga0466694_139082 Ga0466694_139082_2503_3270 255
152 3300042648 Ga0466709_140045 Ga0466709_140045_990_1757 255
153 3300042590 Ga0466690_067040 Ga0466690_067040_3349_4119 256
154 3300042593 Ga0466691_036978 Ga0466691_036978_2745_3515 256
155 3300042595 Ga0466695_063257 Ga0466695_063257_762_1532 256
156 3300042597 Ga0466699_053303 Ga0466699_053303_1683_2453 256
157 3300042597 Ga0466699_078583 Ga0466699_078583_246_1016 256
158 3300042612 Ga0466705_223816 Ga0466705_223816_1672_2487 256
159 3300042615 Ga0466711_300254 Ga0466711_300254_4271_5041 256
160 3300042616 Ga0466715_321429 Ga0466715_321429_6795_7565 256
161 3300042618 Ga0466723_196407 Ga0466723_196407_663_1433 256
162 3300042643 Ga0466704_045761 Ga0466704_045761_6962_7732 256
163 3300042643 Ga0466704_222603 Ga0466704_222603_44409_45179 256
164 3300042643 Ga0466704_293402 Ga0466704_293402_256_1071 256
165 3300042652 Ga0466708_111845 Ga0466708_111845_1584_2354 256
166 3300042652 Ga0466708_461551 Ga0466708_461551_273_1043 256
167 3300002462 JGI24702J35022_10009842 JGI24702J35022_100098425 257
168 3300010167 Ga0123353_10746629 Ga0123353_107466292 257
169 3300042594 Ga0466694_346577 Ga0466694_346577_508_1281 257
170 3300042602 Ga0466713_045396 Ga0466713_045396_107_880 257
171 3300042612 Ga0466705_301735 Ga0466705_301735_1950_2723 257
172 3300042609 Ga0466722_088142 Ga0466722_088142_4022_4798 258
173 3300042606 Ga0466719_035255 Ga0466719_035255_96_875 259
174 3300042615 Ga0466711_037118 Ga0466711_037118_1281_2060 259
175 3300042616 Ga0466715_010756 Ga0466715_010756_3960_4739 259
176 3300042616 Ga0466715_065180 Ga0466715_065180_3896_4675 259
177 3300042643 Ga0466704_612927 Ga0466704_612927_192_971 259
178 3300042619 Ga0466726_304465 Ga0466726_304465_621_1403 260
179 3300042621 Ga0466729_163170 Ga0466729_163170_68092_68874 260
180 iso_pr_bacteria 2781125666 2781342780 260
181 3300009784 Ga0123357_10000033 Ga0123357_1000003370 261
182 3300010882 Ga0123354_10398762 Ga0123354_103987622 261
183 3300042595 Ga0466695_287167 Ga0466695_287167_25_810 261
184 3300042598 Ga0466701_075709 Ga0466701_075709_675_1460 261
185 3300042611 Ga0466697_045139 Ga0466697_045139_7120_7905 261
186 3300042612 Ga0466705_257279 Ga0466705_257279_945_1730 261
187 3300042643 Ga0466704_160094 Ga0466704_160094_5302_6087 261
188 iso_pr_bacteria 2781125655 2781319540 261
189 3300009826 Ga0123355_10099713 Ga0123355_100997134 262
190 3300042612 Ga0466705_081280 Ga0466705_081280_1396_2184 262
191 3300042615 Ga0466711_192109 Ga0466711_192109_1368_2156 262
192 3300042606 Ga0466719_297120 Ga0466719_297120_12_803 263
193 3300009826 Ga0123355_10213793 Ga0123355_102137932 265
194 3300042616 Ga0466715_128970 Ga0466715_128970_2244_3041 265
195 3300042636 Ga0466703_143749 Ga0466703_143749_2883_3680 265
196 3300042591 Ga0466692_158534 Ga0466692_158534_7714_8514 266
197 3300042593 Ga0466691_160224 Ga0466691_160224_7932_8732 266
198 3300007733 Ga0105524_100227 Ga0105524_1002271 267
199 3300042616 Ga0466715_124780 Ga0466715_124780_1618_2448 276
200 3300042596 Ga0466696_053241 Ga0466696_053241_2989_3822 277
201 3300042612 Ga0466705_181525 Ga0466705_181525_2458_3306 282
202 3300042643 Ga0466704_202245 Ga0466704_202245_14987_15835 282
203 3300042605 Ga0466716_028709 Ga0466716_028709_275_1153 292

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 52 202 0.97
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 171 235 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.