Protein Family IF09407

Metagenome Isolate
156 Members
76 Samples
130 Scaffolds
716.33 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_172711|Ga0466704_172711_34675_37257
Length
841 aa
Sequence
MTDILTEADPAVTTALAGRDGVQPKRRRGRDGAHLGRDSAPSDGPGPVAQVVKRDGTVVAFDLARIASAMARAGQASGEFDPAEAELLARFAVRKLDRPRPAVEQIQDSVEATLINAGYHATARAYIVYRENHSRLRADAKVVVDVESSINEYLDRSDWRVNANANQGYSLGGLILNTSGKIIANYWLSHVYSPQIGQAHRQGDLHIHDLDMLSGYCAGWSLRTLLTEGLNGVPGKIDAAPPKHFSSAIGQIVNFLGTLQNEWAGAQAFSSFDTYMAPFVRIDQMTYEQVLQGVQELVYNLNVPSRWGTQTPFTNLTFDWTCPEDLRDQRPVIGGVEQDFAYGDLVEEMALINRAYIEVMTTGDATGRVFTFPIPTYNITADFPWESPNAERLFAMTAKYGLPYFQNFINSELKPNQIRSMCCRLQLDLRELLKRGNGLFGSAEQTGSVGVVTINCARLGYRHAGDEAGLTAALDRLLELARDSLEVKRKVIQRLIDQGLFPYTKRYLGTLRNHFSTIGVNGLHELARNFFAASDPAARDGGLTTQAGHALVVRLLDRVRQLMVEFQEATGHLYNLEATPAEGTTYRFAKEDRRRFPDIIQAGTADNPYYTNSSQLPVGFTDDPFEALSRQDELQRKYTGGTVLHLYMSERLSDATACRELVRRSLSRFSLPYITVTPTFSICPAHGYLAGEQPTCPRCAAEDPTAEPTVCEVWTRVMGYHRPVSSFNIGKRGEHAERRHFRQSRSGLDQPWEPAAVADPSGSAVVALVEGDSAASPEKMPVTSSATPIRSADGTPATTLPAVVPGGMLPAPAAASPVVVLAERPEAAQSAAAEADRAVAA

📊 Sample Types

Isolate 16.7%
Metagenome 83.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.4%
Unclassified 29.6%
Kalotermitidae 18.3%
Elmidae 5.6%
Rhinotermitidae 2.8%
Termopsidae 2.8%
Apidae 1.4%
Crambidae 1.4%
Hodotermitidae 1.4%
Hydrophilidae 1.4%
Gryllidae 1.4%
Drosophilidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
2 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
3 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
4 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
5 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
6 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
7 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
11 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
12 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
17 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
18 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
19 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
20 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
27 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
28 2524614573 Marinospirillum minutulum DSM 6287 Isolate Unclassified
29 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
30 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
31 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
32 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
40 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
41 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
42 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
45 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
55 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
56 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
57 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
61 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
62 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
63 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
64 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
65 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
66 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
67 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
68 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
69 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
70 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
71 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
72 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
73 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
74 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
75 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
76 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_288150 3300042612 Bacteria 3123
2 Ga0466705_498043 3300042612 Bacteria 5915
3 Ga0466718_078965 3300042617 Bacteria 3441
4 Ga0466723_044471 3300042618 Bacteria 37367
5 Ga0123353_10002172 3300010167 Bacteria 24244
6 Ga0160442_101260 3300012806 Unclassified 3180
7 Ga0466730_079807 3300042625 Unclassified 12475
8 Ga0466703_130593 3300042636 Bacteria 20505
9 Ga0466704_344749 3300042643 Bacteria 19051
10 Ga0466716_541786 3300042605 Bacteria 10716
11 Ga0466691_052296 3300042593 Bacteria 20210
12 Ga0466733_090944 3300042659 Bacteria 27056
13 Ga0466723_352003 3300042618 Bacteria 8090
14 Ga0123356_10001003 3300010049 Unclassified 31354
15 Ga0123356_10005470 3300010049 Bacteria 12925
16 Ga0123356_10007057 3300010049 Bacteria 11262
17 Ga0466704_059675 3300042643 Bacteria 5472
18 Ga0466704_351412 3300042643 Bacteria 12877
19 Ga0466708_167251 3300042652 Bacteria 5267
20 Ga0466701_019652 3300042598 Bacteria 12065
21 Ga0466701_032123 3300042598 Bacteria 2299
22 Ga0466706_107376 3300042599 Bacteria 18823
23 Ga0466700_322401 3300042600 Bacteria 81969
24 Ga0466707_119737 3300042601 Bacteria 2564
25 Ga0466713_060774 3300042602 Bacteria 81565
26 Ga0466720_171619 3300042607 Bacteria 38427
27 Ga0466721_294373 3300042608 Unclassified 2932
28 Ga0072941_1012927 3300005201 Bacteria 16034
29 Ga0415639_010880 3300038395 Bacteria 23416
30 Ga0466705_457955 3300042612 Bacteria 8754
31 Ga0466726_047209 3300042619 Bacteria 7488
32 Ga0123356_10002558 3300010049 Bacteria 19429
33 Ga0466731_313060 3300042622 Bacteria 10559
34 Ga0466703_154909 3300042636 Bacteria 28406
35 Ga0466706_251445 3300042599 Bacteria 2839
36 Ga0466722_059403 3300042609 Bacteria 5533
37 JGI24698J34947_10004594 3300002449 Bacteria 7522
38 JGI24695J34938_10000932 3300002450 Bacteria 26747
39 Ga0466657_053153 3300042582 Unclassified 18825
40 Ga0466691_087685 3300042593 Bacteria 7261
41 Ga0466696_258136 3300042596 Bacteria 5766
42 Ga0466732_407384 3300042656 Bacteria 7429
43 Ga0466718_045883 3300042617 Bacteria 65046
44 Ga0466723_046508 3300042618 Bacteria 18039
45 Ga0466723_336610 3300042618 Bacteria 11198
46 Ga0466728_201249 3300042620 Bacteria 76476
47 Ga0466728_449689 3300042620 Bacteria 48197
48 Ga0123356_10008057 3300010049 Bacteria 10483
49 Ga0123356_10011177 3300010049 Bacteria 8767
50 Ga0123356_10017485 3300010049 Bacteria 6821
51 Ga0466703_058209 3300042636 Bacteria 6731
52 Ga0466704_601132 3300042643 Bacteria 181308
53 Ga0466725_058752 3300042654 Bacteria 21946
54 Ga0466713_062246 3300042602 Bacteria 29334
55 Ga0466720_125427 3300042607 Bacteria 2973
56 Ga0072941_1062228 3300005201 Unclassified 4706
57 Ga0105005_1275323 3300007505 Bacteria 4498
58 Ga0466712_268848 3300042614 Bacteria 6971
59 Ga0123355_10000090 3300009826 Bacteria 95669
60 Ga0123356_10017202 3300010049 Bacteria 6881
61 Ga0123353_10179679 3300010167 Bacteria 3351
62 Ga0466703_077981 3300042636 Bacteria 14853
63 Ga0466703_175859 3300042636 Bacteria 4186
64 Ga0466703_314406 3300042636 Bacteria 6293
65 Ga0466704_226752 3300042643 Bacteria 22106
66 Ga0466724_27534 3300042649 Bacteria 146715
67 Ga0466708_403602 3300042652 Bacteria 8493
68 Ga0466716_335106 3300042605 Bacteria 16525
69 JGI24695J34938_10000893 3300002450 Bacteria 27549
70 Ga0072941_1058924 3300005201 Bacteria 5122
71 Ga0466691_025003 3300042593 Bacteria 9115
72 Ga0466691_094163 3300042593 Bacteria 13489
73 Ga0466697_119148 3300042611 Unclassified 8343
74 Ga0466705_352338 3300042612 Bacteria 6603
75 Ga0466715_137255 3300042616 Bacteria 107557
76 Ga0466715_622980 3300042616 Bacteria 273902
77 Ga0466723_093155 3300042618 Bacteria 6495
78 Ga0123356_10000037 3300010049 Bacteria 142433
79 Ga0123356_10002147 3300010049 Bacteria 21250
80 Ga0123356_10021734 3300010049 Bacteria 6057
81 Ga0123356_10074778 3300010049 Unclassified 3189
82 Ga0123353_10048942 3300010167 Bacteria 6733
83 Ga0466703_323284 3300042636 Bacteria 21610
84 Ga0466716_359585 3300042605 Bacteria 9263
85 Ga0466719_150510 3300042606 Bacteria 3785
86 Ga0466721_334270 3300042608 Bacteria 25952
87 JGI24698J34947_10006716 3300002449 Bacteria 6320
88 JGI24698J34947_10007871 3300002449 Unclassified 5853
89 JGI24702J35022_10022164 3300002462 Bacteria 3441
90 Ga0068305_10130782 3300005083 Unclassified 19493
91 Ga0264413_123323 3300024493 Bacteria 11847
92 Ga0466692_049838 3300042591 Bacteria 185020
93 Ga0466691_003390 3300042593 Bacteria 23914
94 Ga0466691_205990 3300042593 Bacteria 57090
95 Ga0466705_059472 3300042612 Bacteria 2880
96 Ga0466705_191328 3300042612 Bacteria 19348
97 Ga0466712_217418 3300042614 Bacteria 3288
98 Ga0466711_203212 3300042615 Bacteria 9064
99 Ga0466711_263485 3300042615 Bacteria 11682
100 Ga0466715_492607 3300042616 Bacteria 3558
101 Ga0466723_012735 3300042618 Bacteria 10327
102 Ga0466726_410068 3300042619 Bacteria 25293
103 Ga0123356_10004544 3300010049 Bacteria 14310
104 Ga0123356_10005029 3300010049 Bacteria 13551
105 Ga0123356_10014742 3300010049 Bacteria 7509
106 Ga0123353_10018386 3300010167 Bacteria 10335
107 Ga0466703_097355 3300042636 Bacteria 13918
108 Ga0466704_172711 3300042643 Bacteria 164859
109 Ga0466704_314163 3300042643 Bacteria 16847
110 Ga0466709_042370 3300042648 Bacteria 9258
111 Ga0466727_074602 3300042655 Bacteria 28685
112 Ga0466706_122046 3300042599 Bacteria 228896
113 Ga0466714_100267 3300042603 Bacteria 2983
114 Ga0466716_037105 3300042605 Unclassified 10352
115 Ga0466719_124462 3300042606 Bacteria 41665
116 Ga0264413_140529 3300024493 Bacteria 21082
117 Ga0466691_018945 3300042593 Bacteria 5782
118 Ga0466691_033095 3300042593 Bacteria 6021
119 Ga0466732_246256 3300042656 Bacteria 5935
120 Ga0123356_10000888 3300010049 Bacteria 33102
121 Ga0123356_10032678 3300010049 Bacteria 4867
122 Ga0466703_406130 3300042636 Bacteria 10979
123 Ga0466704_166356 3300042643 Bacteria 83216
124 Ga0466719_083308 3300042606 Bacteria 41647
125 Ga0466720_011640 3300042607 Unclassified 7991
126 AustNasuHG_c1000094 3300000089 Bacteria 25892
127 JGI24698J34947_10051048 3300002449 Unclassified 2082
128 Ga0072941_1004238 3300005201 Bacteria 114598
129 Ga0160432_100240 3300012818 Unclassified 46873
130 Ga0160452_100319 3300012834 Bacteria 42649

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2524614573 2524999544 585
2 3300042593 Ga0466691_052296 Ga0466691_052296_10414_12465 660
3 3300042652 Ga0466708_167251 Ga0466708_167251_1084_3150 663
4 iso_pr_bacteria 2864745180 2864745962 663
5 iso_pr_bacteria 2864812326 2864814514 663
6 iso_pr_bacteria 2864853652 2864857124 663
7 iso_pr_bacteria 2855798354 2855800836 664
8 3300005201 Ga0072941_1062228 Ga0072941_10622282 665
9 3300042598 Ga0466701_032123 Ga0466701_032123_131_2131 666
10 3300002449 JGI24698J34947_10051048 JGI24698J34947_100510481 667
11 3300007505 Ga0105005_1275323 Ga0105005_12753232 667
12 3300042593 Ga0466691_205990 Ga0466691_205990_34704_36779 667
13 3300042636 Ga0466703_154909 Ga0466703_154909_26031_28040 669
14 3300042606 Ga0466719_083308 Ga0466719_083308_5121_7172 670
15 iso_pr_bacteria 2873565274 2873566671 670
16 3300042620 Ga0466728_449689 Ga0466728_449689_14185_16200 671
17 3300042654 Ga0466725_058752 Ga0466725_058752_6925_8940 671
18 iso_pr_bacteria 2864944480 2864947623 671
19 3300012806 Ga0160442_101260 Ga0160442_1012602 672
20 3300012818 Ga0160432_100240 Ga0160432_10024030 672
21 3300012834 Ga0160452_100319 Ga0160452_10031912 672
22 3300042619 Ga0466726_047209 Ga0466726_047209_2171_4189 672
23 3300042643 Ga0466704_314163 Ga0466704_314163_5708_7789 672
24 3300042605 Ga0466716_359585 Ga0466716_359585_991_3015 674
25 3300042612 Ga0466705_191328 Ga0466705_191328_13780_15804 674
26 iso_pr_bacteria 2870361953 2870364947 674
27 iso_pr_bacteria 3000478755 3000479348 674
28 3300042599 Ga0466706_107376 Ga0466706_107376_13716_15743 675
29 3300042625 Ga0466730_079807 Ga0466730_079807_9950_11977 675
30 3300042649 Ga0466724_27534 Ga0466724_27534_8289_10316 675
31 3300042611 Ga0466697_119148 Ga0466697_119148_3444_5474 676
32 3300042616 Ga0466715_622980 Ga0466715_622980_134685_136745 676
33 iso_pr_bacteria 2891720358 2891721867 676
34 iso_pr_bacteria 2820880921 2820881355 677
35 iso_pr_bacteria 2820934415 2820935207 677
36 3300009826 Ga0123355_10000090 Ga0123355_100000905 678
37 3300042636 Ga0466703_058209 Ga0466703_058209_3340_5376 678
38 3300042636 Ga0466703_323284 Ga0466703_323284_18677_20713 678
39 iso_pr_bacteria 2820042117 2820044700 680
40 3300002462 JGI24702J35022_10022164 JGI24702J35022_100221641 681
41 3300042606 Ga0466719_150510 Ga0466719_150510_372_2417 681
42 3300042618 Ga0466723_352003 Ga0466723_352003_2822_4867 681
43 3300042620 Ga0466728_201249 Ga0466728_201249_57074_59119 681
44 3300042593 Ga0466691_033095 Ga0466691_033095_3703_5751 682
45 3300042593 Ga0466691_094163 Ga0466691_094163_2493_4544 683
46 3300042599 Ga0466706_251445 Ga0466706_251445_335_2386 683
47 3300042612 Ga0466705_059472 Ga0466705_059472_157_2208 683
48 3300042618 Ga0466723_012735 Ga0466723_012735_7571_9622 683
49 3300042636 Ga0466703_130593 Ga0466703_130593_2038_4089 683
50 3300042652 Ga0466708_403602 Ga0466708_403602_3021_5072 683
51 3300042615 Ga0466711_263485 Ga0466711_263485_5519_7573 684
52 3300042659 Ga0466733_090944 Ga0466733_090944_20515_22572 685
53 iso_pr_bacteria 2820103659 2820105794 685
54 3300042596 Ga0466696_258136 Ga0466696_258136_360_2420 686
55 3300042605 Ga0466716_335106 Ga0466716_335106_9553_11622 689
56 iso_pr_bacteria 2820157249 2820157625 689
57 3300042591 Ga0466692_049838 Ga0466692_049838_91168_93282 690
58 3300042603 Ga0466714_100267 Ga0466714_100267_534_2606 690
59 3300042648 Ga0466709_042370 Ga0466709_042370_229_2301 690
60 3300042582 Ga0466657_053153 Ga0466657_053153_6694_8769 691
61 3300042636 Ga0466703_175859 Ga0466703_175859_1991_4066 691
62 3300042605 Ga0466716_037105 Ga0466716_037105_324_2402 692
63 3300042598 Ga0466701_019652 Ga0466701_019652_4083_6170 695
64 3300042605 Ga0466716_541786 Ga0466716_541786_5223_7313 696
65 3300042614 Ga0466712_217418 Ga0466712_217418_925_3087 698
66 3300002449 JGI24698J34947_10006716 JGI24698J34947_100067165 699
67 3300042636 Ga0466703_077981 Ga0466703_077981_8720_10825 701
68 3300042656 Ga0466732_246256 Ga0466732_246256_3135_5240 701
69 3300042612 Ga0466705_352338 Ga0466705_352338_4334_6442 702
70 3300042612 Ga0466705_288150 Ga0466705_288150_621_2792 703
71 3300042615 Ga0466711_203212 Ga0466711_203212_932_3043 703
72 3300042656 Ga0466732_407384 Ga0466732_407384_285_2396 703
73 3300010167 Ga0123353_10002172 Ga0123353_100021723 704
74 3300002449 JGI24698J34947_10004594 JGI24698J34947_100045942 705
75 3300042600 Ga0466700_322401 Ga0466700_322401_5673_7790 705
76 3300005201 Ga0072941_1058924 Ga0072941_10589241 707
77 3300042643 Ga0466704_059675 Ga0466704_059675_667_2790 707
78 3300002449 JGI24698J34947_10007871 JGI24698J34947_100078711 708
79 3300005201 Ga0072941_1004238 Ga0072941_100423853 708
80 3300042607 Ga0466720_011640 Ga0466720_011640_4357_6483 708
81 3300042617 Ga0466718_078965 Ga0466718_078965_613_2739 708
82 3300042618 Ga0466723_093155 Ga0466723_093155_2198_4324 708
83 3300042622 Ga0466731_313060 Ga0466731_313060_2028_4154 708
84 iso_pr_bacteria 2820911766 2820913471 708
85 3300042601 Ga0466707_119737 Ga0466707_119737_405_2537 710
86 3300042614 Ga0466712_268848 Ga0466712_268848_59_2242 710
87 3300010049 Ga0123356_10004544 Ga0123356_100045449 711
88 3300042618 Ga0466723_336610 Ga0466723_336610_7429_9564 711
89 iso_pr_bacteria 2820161938 2820162402 711
90 3300024493 Ga0264413_123323 Ga0264413_1233233 712
91 3300042607 Ga0466720_125427 Ga0466720_125427_472_2610 712
92 3300042593 Ga0466691_087685 Ga0466691_087685_4456_6624 715
93 3300000089 AustNasuHG_c1000094 AustNasuHG_10000941 716
94 3300005201 Ga0072941_1012927 Ga0072941_10129275 716
95 iso_pr_bacteria 2773857778 2774475903 716
96 iso_pr_bacteria 2778260936 2778346091 716
97 3300002450 JGI24695J34938_10000893 JGI24695J34938_100008934 717
98 iso_pr_bacteria 2820442516 2820444442 719
99 3300042607 Ga0466720_171619 Ga0466720_171619_29002_31167 721
100 3300042608 Ga0466721_334270 Ga0466721_334270_12983_15148 721
101 3300042617 Ga0466718_045883 Ga0466718_045883_36142_38307 721
102 3300042612 Ga0466705_457955 Ga0466705_457955_4002_6170 722
103 iso_pr_bacteria 2778260935 2778344334 722
104 iso_pr_bacteria 2778260938 2778350817 722
105 3300002450 JGI24695J34938_10000932 JGI24695J34938_1000093217 723
106 3300042618 Ga0466723_046508 Ga0466723_046508_541_2712 723
107 3300042643 Ga0466704_166356 Ga0466704_166356_77787_79958 723
108 3300042643 Ga0466704_226752 Ga0466704_226752_13906_16080 724
109 3300042618 Ga0466723_044471 Ga0466723_044471_20016_22199 727
110 3300042606 Ga0466719_124462 Ga0466719_124462_4947_7133 728
111 3300042609 Ga0466722_059403 Ga0466722_059403_3255_5441 728
112 3300042636 Ga0466703_314406 Ga0466703_314406_3324_5510 728
113 3300042612 Ga0466705_498043 Ga0466705_498043_3373_5562 729
114 3300042616 Ga0466715_137255 Ga0466715_137255_26873_29065 730
115 3300042593 Ga0466691_025003 Ga0466691_025003_2654_4900 732
116 3300042643 Ga0466704_344749 Ga0466704_344749_10297_12495 732
117 3300042616 Ga0466715_492607 Ga0466715_492607_832_3033 733
118 3300042636 Ga0466703_097355 Ga0466703_097355_7424_9634 736
119 3300042643 Ga0466704_351412 Ga0466704_351412_4473_6683 736
120 3300042593 Ga0466691_003390 Ga0466691_003390_20135_22366 743
121 3300042643 Ga0466704_601132 Ga0466704_601132_80751_82985 744
122 3300042602 Ga0466713_060774 Ga0466713_060774_53559_55877 750
123 3300042636 Ga0466703_406130 Ga0466703_406130_1696_3948 750
124 3300042602 Ga0466713_062246 Ga0466713_062246_15075_17426 757
125 3300005083 Ga0068305_10130782 Ga0068305_1013078220 758
126 3300010049 Ga0123356_10014742 Ga0123356_100147423 774
127 3300010049 Ga0123356_10017485 Ga0123356_100174853 778
128 3300038395 Ga0415639_010880 Ga0415639_010880_19890_22226 778
129 3300010049 Ga0123356_10032678 Ga0123356_100326783 780
130 3300010049 Ga0123356_10002558 Ga0123356_1000255810 783
131 3300042619 Ga0466726_410068 Ga0466726_410068_19941_22295 784
132 3300042655 Ga0466727_074602 Ga0466727_074602_20343_22697 784
133 3300010049 Ga0123356_10002147 Ga0123356_1000214719 785
134 3300010049 Ga0123356_10074778 Ga0123356_100747782 786
135 3300024493 Ga0264413_140529 Ga0264413_1405296 786
136 iso_pr_bacteria 2820566695 2820568216 786
137 3300010049 Ga0123356_10001003 Ga0123356_1000100313 787
138 3300010049 Ga0123356_10021734 Ga0123356_100217343 788
139 3300010049 Ga0123356_10008057 Ga0123356_100080573 791
140 3300010049 Ga0123356_10000888 Ga0123356_1000088827 792
141 3300010049 Ga0123356_10005470 Ga0123356_100054704 794
142 3300010167 Ga0123353_10179679 Ga0123353_101796791 794
143 iso_pr_bacteria 2820563109 2820563323 794
144 3300010049 Ga0123356_10000037 Ga0123356_1000003725 795
145 3300042599 Ga0466706_122046 Ga0466706_122046_212215_214602 795
146 3300010049 Ga0123356_10011177 Ga0123356_100111774 797
147 3300010049 Ga0123356_10007057 Ga0123356_100070576 798
148 3300010167 Ga0123353_10048942 Ga0123353_100489421 798
149 3300010049 Ga0123356_10005029 Ga0123356_100050299 800
150 3300010167 Ga0123353_10018386 Ga0123353_100183866 800
151 iso_pr_bacteria 2820246658 2820247114 801
152 3300010049 Ga0123356_10017202 Ga0123356_100172025 807
153 3300042608 Ga0466721_294373 Ga0466721_294373_154_2586 810
154 3300042593 Ga0466691_018945 Ga0466691_018945_2841_5288 815
155 3300042643 Ga0466704_172711 Ga0466704_172711_34675_37257 841
156 iso_pr_bacteria 2820688768 2820690223 849

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03477 ATP-cone ATP cone domain 50 134 0.95
PF13597 NRDD Anaerobic ribonucleoside-triphosphate reductase 164 741 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.