Protein Family IF09393

Metagenome Isolate
162 Members
50 Samples
151 Scaffolds
308.79 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_150000|Ga0466704_150000_10222_11268
Length
348 aa
Sequence
LSESRLSVPPPAGRAGIIKTAAVTALAGNLFLAVLKIGAGIHSGSMAVLGDGIDSSVDVLIALMSLMVSAVISRPADAGHPWGHGRAETVATAVLSFILFFAGAQLVLNSIVNVFSGSLRAVPGKIALAATAVSIIGKLILAWSQYRFSKKAVSAMLLANAKNMAADVIISAGVLAGLGLSMIFNLGAIDSVAAILVGLWIIKSAIGIFREANAELMDGGSETGSYRAVFDAVHSVKGAGRPHRARMRRIAGFWDIDIDIEVDPNLTVLEAHHIASQVEQAVKARLEGVYDIMIHVEPAGNTETEGFGLCEAAFSGGTGGQTVSKVPAAGYTQGGGESGDGIHERGKP

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 28.6%
Unclassified 24.5%
Termopsidae 8.2%
Rhinotermitidae 4.1%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 2
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
3 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
4 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
5 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
23 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
24 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
47 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10021215 3300010167 Bacteria 9742
2 Ga0123353_10328329 3300010167 Bacteria 2317
3 Ga0466691_037477 3300042593 Bacteria 8832
4 Ga0466691_048757 3300042593 Bacteria 5452
5 Ga0466691_131868 3300042593 Bacteria 13463
6 Ga0466696_494623 3300042596 Bacteria 1309
7 Ga0466699_150539 3300042597 Bacteria 7264
8 Ga0466699_224685 3300042597 Bacteria 1755
9 Ga0466699_225424 3300042597 Bacteria 25238
10 Ga0466699_271348 3300042597 Bacteria 6453
11 Ga0466735_002824 3300042624 Bacteria 2866
12 Ga0466735_109972 3300042624 Bacteria 3095
13 Ga0466703_395122 3300042636 Bacteria 51270
14 Ga0466708_094298 3300042652 Bacteria 34608
15 Ga0466708_334123 3300042652 Bacteria 55617
16 Ga0466727_243152 3300042655 Bacteria 2657
17 Ga0466705_516357 3300042612 Bacteria 5240
18 JGI24702J35022_10009650 3300002462 Bacteria 5413
19 Ga0466716_008551 3300042605 Bacteria 3274
20 Ga0466719_064049 3300042606 Bacteria 9646
21 Ga0466719_106973 3300042606 Bacteria 29739
22 Ga0466719_515100 3300042606 Bacteria 3782
23 Ga0466722_205738 3300042609 Bacteria 4020
24 Ga0466733_025864 3300042659 Bacteria 1097
25 Ga0466733_070378 3300042659 Bacteria 5419
26 Ga0466733_096343 3300042659 Archaea 5641
27 Ga0123355_10149223 3300009826 Bacteria 3556
28 Ga0466690_190948 3300042590 Bacteria 7905
29 Ga0466699_273821 3300042597 Bacteria 24467
30 Ga0466729_214010 3300042621 Bacteria 1283
31 Ga0466702_453167 3300042635 Bacteria 35795
32 Ga0466703_299289 3300042636 Bacteria 42101
33 Ga0466708_117433 3300042652 Bacteria 5485
34 Ga0466708_247106 3300042652 Bacteria 17278
35 Ga0466725_340443 3300042654 Bacteria 1185
36 Ga0466712_201317 3300042614 Bacteria 4337
37 Ga0466712_283203 3300042614 Bacteria 1756
38 Ga0466711_125348 3300042615 Bacteria 5289
39 Ga0466711_336895 3300042615 Bacteria 8777
40 Ga0466715_020972 3300042616 Bacteria 4918
41 Ga0466723_297867 3300042618 Bacteria 3847
42 Ga0466726_106933 3300042619 Bacteria 2959
43 Ga0466726_307099 3300042619 Bacteria 10650
44 Ga0466728_396949 3300042620 Bacteria 3671
45 JGI24695J34938_10039832 3300002450 Bacteria 2119
46 Ga0072941_1013071 3300005201 Bacteria 4931
47 Ga0123353_10030981 3300010167 Bacteria 8276
48 Ga0123353_10134018 3300010167 Bacteria 3974
49 Ga0123353_10720976 3300010167 Bacteria 1395
50 Ga0466690_045747 3300042590 Bacteria 6514
51 Ga0466704_395897 3300042643 Bacteria 4963
52 Ga0466709_292499 3300042648 Bacteria 1094
53 Ga0466708_056326 3300042652 Bacteria 4576
54 Ga0466723_324439 3300042618 Bacteria 6518
55 Ga0466726_234889 3300042619 Bacteria 4125
56 JGI24695J34938_10081368 3300002450 Bacteria 1337
57 Ga0068302_10085444 3300005071 Bacteria 1458
58 Ga0466707_100112 3300042601 Bacteria 2845
59 Ga0466714_029288 3300042603 Bacteria 19529
60 Ga0466716_031754 3300042605 Bacteria 3084
61 Ga0466716_088790 3300042605 Bacteria 15243
62 Ga0466732_277535 3300042656 Bacteria 2436
63 Ga0123353_10000607 3300010167 Bacteria 43915
64 Ga0123353_10020754 3300010167 Bacteria 9828
65 Ga0123353_10067137 3300010167 Bacteria 5759
66 Ga0123353_10565371 3300010167 Bacteria 1636
67 Ga0466699_077058 3300042597 Bacteria 1948
68 Ga0466705_097728 3300042612 Bacteria 3154
69 Ga0466729_278148 3300042621 Bacteria 2941
70 Ga0466708_025650 3300042652 Bacteria 9449
71 Ga0466725_035820 3300042654 Unclassified 1764
72 Ga0466727_125991 3300042655 Bacteria 25498
73 Ga0466723_083510 3300042618 Bacteria 16681
74 Ga0466726_129985 3300042619 Bacteria 11594
75 Ga0466728_355860 3300042620 Bacteria 2850
76 JGI24698J34947_10004681 3300002449 Bacteria 7467
77 JGI24702J35022_10003691 3300002462 Bacteria 9212
78 Ga0123353_10125650 3300010167 Bacteria 4122
79 Ga0123354_10009654 3300010882 Unclassified 14809
80 Ga0466699_060827 3300042597 Bacteria 12698
81 Ga0466699_079946 3300042597 Bacteria 2019
82 Ga0466699_171103 3300042597 Bacteria 1948
83 Ga0466709_271299 3300042648 Bacteria 3042
84 Ga0466709_316316 3300042648 Bacteria 3963
85 Ga0466708_162794 3300042652 Bacteria 2336
86 Ga0466715_192391 3300042616 Bacteria 3672
87 Ga0466715_584290 3300042616 Bacteria 44080
88 Ga0466723_110458 3300042618 Unclassified 2375
89 Ga0466726_076299 3300042619 Bacteria 8984
90 Ga0466726_099110 3300042619 Bacteria 5537
91 JGI24702J35022_10063012 3300002462 Unclassified 1986
92 Ga0466722_089922 3300042609 Bacteria 16066
93 Ga0123353_10354977 3300010167 Bacteria 2207
94 Ga0466693_306910 3300042592 Bacteria 1978
95 Ga0466693_354034 3300042592 Bacteria 1046
96 Ga0466691_145840 3300042593 Bacteria 3333
97 Ga0466691_170012 3300042593 Bacteria 38393
98 Ga0466699_391055 3300042597 Bacteria 1446
99 Ga0466705_078068 3300042612 Bacteria 6832
100 Ga0466705_107554 3300042612 Bacteria 51815
101 Ga0466705_146012 3300042612 Bacteria 5446
102 Ga0466734_017481 3300042623 Bacteria 1620
103 Ga0466735_077041 3300042624 Bacteria 4161
104 Ga0466735_203569 3300042624 Bacteria 1196
105 Ga0466704_050012 3300042643 Bacteria 28642
106 Ga0466708_026869 3300042652 Bacteria 23353
107 Ga0466708_180930 3300042652 Bacteria 28002
108 Ga0466727_307575 3300042655 Bacteria 4446
109 Ga0466712_030831 3300042614 Bacteria 8751
110 Ga0466711_102447 3300042615 Bacteria 1960
111 Ga0466715_096439 3300042616 Bacteria 11717
112 Ga0466715_228501 3300042616 Bacteria 6327
113 Ga0466715_243549 3300042616 Bacteria 13882
114 Ga0466728_241551 3300042620 Bacteria 2388
115 Ga0466713_051608 3300042602 Bacteria 15387
116 Ga0466719_040941 3300042606 Bacteria 11354
117 Ga0466719_198559 3300042606 Bacteria 41330
118 Ga0466722_108418 3300042609 Bacteria 2174
119 Ga0415639_183358 3300038395 Bacteria 1813
120 Ga0466696_059708 3300042596 Bacteria 6370
121 Ga0466699_042156 3300042597 Bacteria 4511
122 Ga0466703_010528 3300042636 Bacteria 12005
123 Ga0466703_152808 3300042636 Bacteria 6052
124 Ga0466709_330050 3300042648 Unclassified 1676
125 Ga0466711_025590 3300042615 Bacteria 41697
126 Ga0466715_032548 3300042616 Bacteria 5942
127 Ga0466715_097861 3300042616 Bacteria 28870
128 Ga0466715_243700 3300042616 Bacteria 14030
129 Ga0466726_019415 3300042619 Bacteria 3078
130 Ga0466728_074275 3300042620 Archaea 2943
131 JGI24695J34938_10000056 3300002450 Bacteria 90027
132 Ga0466722_260697 3300042609 Bacteria 5136
133 Ga0123353_10016099 3300010167 Bacteria 10910
134 Ga0123353_10613989 3300010167 Bacteria 1550
135 Ga0466705_054038 3300042612 Bacteria 24746
136 Ga0466705_197819 3300042612 Bacteria 6966
137 Ga0466735_001917 3300042624 Bacteria 2864
138 Ga0466703_042652 3300042636 Bacteria 6914
139 Ga0466704_150000 3300042643 Bacteria 11947
140 Ga0466704_299159 3300042643 Bacteria 58999
141 Ga0466709_394666 3300042648 Bacteria 4809
142 Ga0466708_414427 3300042652 Bacteria 13597
143 Ga0466711_243497 3300042615 Bacteria 28433
144 Ga0466723_074698 3300042618 Bacteria 11273
145 Ga0466723_319271 3300042618 Bacteria 5989
146 Ga0466726_288572 3300042619 Bacteria 2239
147 Ga0466726_320937 3300042619 Bacteria 1462
148 Ga0466726_451043 3300042619 Bacteria 2154
149 JGI24695J34938_10000627 3300002450 Bacteria 33643
150 Ga0466716_144134 3300042605 Bacteria 27339
151 Ga0466716_383918 3300042605 Unclassified 1617

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_076299 Ga0466726_076299_7373_8185 270
2 3300042612 Ga0466705_146012 Ga0466705_146012_137_976 279
3 3300010167 Ga0123353_10067137 Ga0123353_100671377 281
4 3300042652 Ga0466708_094298 Ga0466708_094298_1930_2868 282
5 3300010167 Ga0123353_10613989 Ga0123353_106139892 285
6 3300042624 Ga0466735_203569 Ga0466735_203569_165_1091 285
7 3300042612 Ga0466705_054038 Ga0466705_054038_4260_5216 287
8 3300002462 JGI24702J35022_10003691 JGI24702J35022_100036912 288
9 3300042593 Ga0466691_170012 Ga0466691_170012_1889_2755 288
10 3300042659 Ga0466733_070378 Ga0466733_070378_3962_4903 289
11 3300010167 Ga0123353_10565371 Ga0123353_105653712 291
12 3300042616 Ga0466715_020972 Ga0466715_020972_3272_4225 291
13 3300042619 Ga0466726_451043 Ga0466726_451043_540_1475 291
14 3300042621 Ga0466729_214010 Ga0466729_214010_237_1112 291
15 3300009826 Ga0123355_10149223 Ga0123355_101492233 292
16 3300042620 Ga0466728_355860 Ga0466728_355860_1509_2444 293
17 3300042636 Ga0466703_010528 Ga0466703_010528_10481_11425 293
18 3300042609 Ga0466722_089922 Ga0466722_089922_4690_5637 294
19 3300042620 Ga0466728_074275 Ga0466728_074275_379_1293 294
20 3300042652 Ga0466708_414427 Ga0466708_414427_3943_4878 294
21 3300042652 Ga0466708_334123 Ga0466708_334123_53938_54876 295
22 3300002450 JGI24695J34938_10000627 JGI24695J34938_100006275 296
23 3300042601 Ga0466707_100112 Ga0466707_100112_545_1519 296
24 3300042605 Ga0466716_031754 Ga0466716_031754_1529_2464 296
25 3300042616 Ga0466715_097861 Ga0466715_097861_9620_10603 297
26 3300042635 Ga0466702_453167 Ga0466702_453167_31225_32217 297
27 3300010167 Ga0123353_10328329 Ga0123353_103283292 298
28 3300042592 Ga0466693_306910 Ga0466693_306910_791_1717 298
29 3300042596 Ga0466696_494623 Ga0466696_494623_88_984 298
30 3300042652 Ga0466708_162794 Ga0466708_162794_383_1279 298
31 3300042614 Ga0466712_030831 Ga0466712_030831_1878_2828 299
32 3300042615 Ga0466711_102447 Ga0466711_102447_619_1584 299
33 3300042652 Ga0466708_180930 Ga0466708_180930_18239_19186 299
34 3300042652 Ga0466708_247106 Ga0466708_247106_14316_15263 299
35 3300042619 Ga0466726_234889 Ga0466726_234889_299_1201 300
36 3300002450 JGI24695J34938_10039832 JGI24695J34938_100398322 301
37 3300042596 Ga0466696_059708 Ga0466696_059708_322_1263 301
38 3300042621 Ga0466729_278148 Ga0466729_278148_390_1352 301
39 3300042593 Ga0466691_048757 Ga0466691_048757_1713_2654 302
40 3300042597 Ga0466699_225424 Ga0466699_225424_5623_6531 302
41 3300042597 Ga0466699_273821 Ga0466699_273821_5659_6567 302
42 3300042659 Ga0466733_096343 Ga0466733_096343_4598_5527 302
43 3300042606 Ga0466719_040941 Ga0466719_040941_3076_4002 303
44 3300042606 Ga0466719_106973 Ga0466719_106973_2479_3408 303
45 3300042612 Ga0466705_107554 Ga0466705_107554_1413_2354 303
46 3300042612 Ga0466705_516357 Ga0466705_516357_2944_3912 303
47 3300042616 Ga0466715_243700 Ga0466715_243700_11594_12505 303
48 3300042618 Ga0466723_319271 Ga0466723_319271_2407_3318 303
49 3300042643 Ga0466704_299159 Ga0466704_299159_5287_6228 303
50 3300042597 Ga0466699_042156 Ga0466699_042156_1896_2810 304
51 3300042597 Ga0466699_077058 Ga0466699_077058_159_1073 304
52 3300042602 Ga0466713_051608 Ga0466713_051608_11345_12274 304
53 3300042616 Ga0466715_032548 Ga0466715_032548_2814_3785 304
54 3300042592 Ga0466693_354034 Ga0466693_354034_57_974 305
55 3300042597 Ga0466699_079946 Ga0466699_079946_61_978 305
56 3300042597 Ga0466699_150539 Ga0466699_150539_1779_2696 305
57 3300042597 Ga0466699_171103 Ga0466699_171103_571_1488 305
58 3300042597 Ga0466699_271348 Ga0466699_271348_5002_5919 305
59 3300042597 Ga0466699_391055 Ga0466699_391055_123_1040 305
60 3300042615 Ga0466711_025590 Ga0466711_025590_29805_30737 305
61 3300042616 Ga0466715_584290 Ga0466715_584290_25040_25990 305
62 3300042619 Ga0466726_129985 Ga0466726_129985_3293_4210 305
63 3300042636 Ga0466703_395122 Ga0466703_395122_60_1028 305
64 3300042659 Ga0466733_025864 Ga0466733_025864_32_1000 305
65 3300002450 JGI24695J34938_10081368 JGI24695J34938_100813681 306
66 3300042614 Ga0466712_283203 Ga0466712_283203_693_1649 306
67 3300042618 Ga0466723_074698 Ga0466723_074698_8800_9720 306
68 3300042648 Ga0466709_316316 Ga0466709_316316_256_1176 306
69 3300042603 Ga0466714_029288 Ga0466714_029288_1449_2372 307
70 3300042636 Ga0466703_042652 Ga0466703_042652_3285_4262 307
71 3300042593 Ga0466691_037477 Ga0466691_037477_5603_6529 308
72 3300042597 Ga0466699_224685 Ga0466699_224685_352_1278 308
73 3300042618 Ga0466723_324439 Ga0466723_324439_4558_5502 308
74 3300042619 Ga0466726_106933 Ga0466726_106933_1796_2722 308
75 3300042636 Ga0466703_299289 Ga0466703_299289_6048_6974 308
76 3300042643 Ga0466704_050012 Ga0466704_050012_15123_16049 308
77 3300042655 Ga0466727_243152 Ga0466727_243152_994_1920 308
78 3300042655 Ga0466727_307575 Ga0466727_307575_1229_2155 308
79 3300042655 Ga0466727_125991 Ga0466727_125991_24456_25385 309
80 iso_pr_bacteria 2820252425 2820254308 309
81 iso_pr_bacteria 2820444930 2820445776 309
82 3300010167 Ga0123353_10021215 Ga0123353_100212152 310
83 3300042616 Ga0466715_228501 Ga0466715_228501_2780_3712 310
84 3300042619 Ga0466726_320937 Ga0466726_320937_508_1440 310
85 3300042656 Ga0466732_277535 Ga0466732_277535_381_1313 310
86 3300002462 JGI24702J35022_10063012 JGI24702J35022_100630122 311
87 3300010167 Ga0123353_10000607 Ga0123353_1000060715 311
88 3300010167 Ga0123353_10720976 Ga0123353_107209762 311
89 3300042597 Ga0466699_060827 Ga0466699_060827_11101_12036 311
90 3300042612 Ga0466705_197819 Ga0466705_197819_4330_5283 311
91 3300042618 Ga0466723_110458 Ga0466723_110458_169_1104 311
92 3300042643 Ga0466704_395897 Ga0466704_395897_3702_4664 311
93 iso_pr_bacteria 2820663833 2820664841 311
94 iso_pr_bacteria 2820671341 2820671966 311
95 iso_pr_bacteria 2820698910 2820700534 311
96 3300002450 JGI24695J34938_10000056 JGI24695J34938_1000005636 312
97 3300042590 Ga0466690_190948 Ga0466690_190948_1365_2303 312
98 3300042593 Ga0466691_131868 Ga0466691_131868_7298_8236 312
99 3300042605 Ga0466716_008551 Ga0466716_008551_1736_2674 312
100 3300042616 Ga0466715_243549 Ga0466715_243549_2259_3197 312
101 3300042618 Ga0466723_297867 Ga0466723_297867_1900_2838 312
102 3300042620 Ga0466728_241551 Ga0466728_241551_96_1034 312
103 3300042636 Ga0466703_152808 Ga0466703_152808_980_1918 312
104 3300042654 Ga0466725_035820 Ga0466725_035820_473_1411 312
105 3300038395 Ga0415639_183358 Ga0415639_183358_425_1366 313
106 3300042648 Ga0466709_271299 Ga0466709_271299_1959_2900 313
107 3300002462 JGI24702J35022_10009650 JGI24702J35022_100096502 314
108 3300042615 Ga0466711_243497 Ga0466711_243497_7202_8146 314
109 3300042654 Ga0466725_340443 Ga0466725_340443_31_975 314
110 iso_pr_bacteria 650716099 650877311 314
111 3300010167 Ga0123353_10134018 Ga0123353_101340183 315
112 3300042612 Ga0466705_078068 Ga0466705_078068_5727_6689 315
113 3300042652 Ga0466708_025650 Ga0466708_025650_7527_8474 315
114 iso_pr_bacteria 2781125683 2781410604 315
115 3300010167 Ga0123353_10354977 Ga0123353_103549772 316
116 3300042606 Ga0466719_198559 Ga0466719_198559_12406_13356 316
117 3300042618 Ga0466723_083510 Ga0466723_083510_12354_13304 316
118 3300042624 Ga0466735_001917 Ga0466735_001917_140_1090 316
119 3300042624 Ga0466735_002824 Ga0466735_002824_140_1090 316
120 3300042648 Ga0466709_394666 Ga0466709_394666_606_1583 316
121 3300005071 Ga0068302_10085444 Ga0068302_100854441 317
122 3300042609 Ga0466722_108418 Ga0466722_108418_747_1718 317
123 3300042609 Ga0466722_205738 Ga0466722_205738_1853_2806 317
124 3300042609 Ga0466722_260697 Ga0466722_260697_4004_4975 317
125 3300042615 Ga0466711_125348 Ga0466711_125348_1724_2677 317
126 3300042616 Ga0466715_096439 Ga0466715_096439_4438_5391 317
127 3300042623 Ga0466734_017481 Ga0466734_017481_435_1388 317
128 3300010167 Ga0123353_10020754 Ga0123353_100207545 318
129 3300042605 Ga0466716_088790 Ga0466716_088790_9822_10778 318
130 3300042619 Ga0466726_019415 Ga0466726_019415_537_1493 318
131 3300042619 Ga0466726_307099 Ga0466726_307099_1468_2424 318
132 3300042652 Ga0466708_056326 Ga0466708_056326_3205_4161 318
133 iso_pr_bacteria 2820422691 2820423850 318
134 3300042620 Ga0466728_396949 Ga0466728_396949_16_975 319
135 3300042624 Ga0466735_077041 Ga0466735_077041_2035_2994 319
136 3300042648 Ga0466709_292499 Ga0466709_292499_57_1031 319
137 iso_pr_bacteria 2772190975 2773721403 319
138 iso_pr_bacteria 2781125640 2781288490 319
139 3300042614 Ga0466712_201317 Ga0466712_201317_572_1534 320
140 3300042619 Ga0466726_099110 Ga0466726_099110_2079_3056 320
141 3300042652 Ga0466708_117433 Ga0466708_117433_294_1256 320
142 3300042652 Ga0466708_026869 Ga0466708_026869_16174_17139 321
143 3300010167 Ga0123353_10030981 Ga0123353_100309819 322
144 iso_pr_bacteria 2820405014 2820405244 322
145 3300005201 Ga0072941_1013071 Ga0072941_10130714 323
146 3300010167 Ga0123353_10016099 Ga0123353_1001609911 323
147 3300010882 Ga0123354_10009654 Ga0123354_100096549 323
148 3300042605 Ga0466716_383918 Ga0466716_383918_450_1454 323
149 3300042606 Ga0466719_515100 Ga0466719_515100_2428_3399 323
150 3300042605 Ga0466716_144134 Ga0466716_144134_4857_5834 325
151 3300042606 Ga0466719_064049 Ga0466719_064049_7959_8936 325
152 3300042616 Ga0466715_192391 Ga0466715_192391_2237_3214 325
153 3300042593 Ga0466691_145840 Ga0466691_145840_2253_3233 326
154 3300042648 Ga0466709_330050 Ga0466709_330050_70_1050 326
155 3300010167 Ga0123353_10125650 Ga0123353_101256503 328
156 3300002449 JGI24698J34947_10004681 JGI24698J34947_100046812 331
157 3300042615 Ga0466711_336895 Ga0466711_336895_6139_7137 332
158 3300042619 Ga0466726_288572 Ga0466726_288572_62_1060 332
159 3300042612 Ga0466705_097728 Ga0466705_097728_914_1921 335
160 3300042590 Ga0466690_045747 Ga0466690_045747_5316_6335 339
161 3300042624 Ga0466735_109972 Ga0466735_109972_387_1406 339
162 3300042643 Ga0466704_150000 Ga0466704_150000_10222_11268 348

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01545 Cation_efflux Cation efflux family 24 217 0.98
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 226 299 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.