Protein Family IF09385

Metagenome Isolate
124 Members
38 Samples
115 Scaffolds
486.13 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_140178|Ga0466704_140178_15569_17179
Length
536 aa
Sequence
MVNHFKVSPVLSAAVGAGIGFYCLSVLFRTDIIGVYGIVAVFLIPTTVLSLLRVLVFFPAFFSAKNIEGSSEAGCLSWGRPLPDFRFVHLANRGVLAFAAGLALGLGMGGAAVNDISFGIPHNTVKAVSGVLLEDPRIVSGGRAMATLSLRETSGGGGLRVSAKGELPVFFPDESAARLREFGRGSVVFAEGNLRVSAYGTAGQEVPWLFSSESMHMVKPAPGLECFRTGLRLSLIRRFAPASVRSSASAGNGDYWGGLALALLLGIKDNLESGLSALYRDAGCSYVLALSGMHLAVLAAIIALLLKKPLGPRFAAIAGALIISIYCFIVGPLPSLIRAALMYLLGVLALLGALKREPLSLLGMAFLVQIVISPQSGFSLSFILSYLALVGILSAGEALNSIFKGKVPVCLLGPLSASLGAFLATAGVTAYFFGILRPVGIITGLVLVPLTTVFMIGSIAWLVLDFVSPFLSGFLNPALSLLYYLMEKTVSLAGQAPGFASGKPPLILALSLGLWLFLVCFEYRRRIAKNRIVAFV

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.8%
Unclassified 25.0%
Kalotermitidae 16.7%
Rhinotermitidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
22 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
23 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
24 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
25 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
26 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
27 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_091318 3300042656 Bacteria 8624
2 Ga0123356_10000125 3300010049 Bacteria 84722
3 Ga0466718_108588 3300042617 Bacteria 22533
4 Ga0466702_024190 3300042635 Bacteria 2453
5 Ga0466702_154134 3300042635 Bacteria 22134
6 Ga0466704_140178 3300042643 Bacteria 60046
7 JGI24698J34947_10000295 3300002449 Bacteria 21660
8 JGI24695J34938_10001318 3300002450 Bacteria 21600
9 Ga0072940_1023808 3300005200 Bacteria 3806
10 Ga0415639_022188 3300038395 Bacteria 15573
11 Ga0415639_072901 3300038395 Bacteria 6473
12 Ga0466692_055727 3300042591 Bacteria 8589
13 Ga0466691_070342 3300042593 Bacteria 7373
14 Ga0466694_055897 3300042594 Bacteria 21390
15 Ga0466694_322816 3300042594 Bacteria 19824
16 Ga0466699_082500 3300042597 Bacteria 19471
17 Ga0466699_103536 3300042597 Bacteria 10825
18 Ga0466732_159474 3300042656 Bacteria 10234
19 Ga0466712_022565 3300042614 Bacteria 13421
20 Ga0466712_074391 3300042614 Bacteria 3344
21 Ga0466712_101890 3300042614 Bacteria 13617
22 Ga0466712_271960 3300042614 Bacteria 7096
23 Ga0466712_297429 3300042614 Bacteria 2879
24 Ga0466723_022467 3300042618 Bacteria 12915
25 JGI24698J34947_10013755 3300002449 Bacteria 4408
26 Ga0072941_1014673 3300005201 Bacteria 10615
27 Ga0072941_1044264 3300005201 Bacteria 8800
28 Ga0074263_114015 3300005485 Bacteria 3862
29 Ga0466720_036827 3300042607 Bacteria 40262
30 Ga0466720_039534 3300042607 Bacteria 41363
31 Ga0264413_104053 3300024493 Bacteria 17683
32 Ga0466692_117410 3300042591 Bacteria 6992
33 Ga0466699_191805 3300042597 Bacteria 14269
34 Ga0466699_414897 3300042597 Bacteria 2375
35 Ga0123356_10050087 3300010049 Bacteria 3888
36 Ga0466712_257317 3300042614 Bacteria 24558
37 Ga0466718_095301 3300042617 Bacteria 25433
38 Ga0466731_388856 3300042622 Bacteria 12781
39 Ga0466702_197588 3300042635 Bacteria 25284
40 JGI24698J34947_10002125 3300002449 Bacteria 10606
41 JGI24698J34947_10014153 3300002449 Bacteria 4344
42 Ga0072941_1014704 3300005201 Bacteria 8350
43 Ga0466720_213637 3300042607 Bacteria 10509
44 Ga0264413_102233 3300024493 Bacteria 6779
45 Ga0466694_034645 3300042594 Bacteria 15920
46 Ga0466694_126938 3300042594 Bacteria 17529
47 Ga0466699_036221 3300042597 Bacteria 24269
48 Ga0466699_439518 3300042597 Bacteria 2457
49 Ga0466705_266113 3300042612 Bacteria 67009
50 Ga0123353_10355469 3300010167 Bacteria 2205
51 Ga0466718_091361 3300042617 Bacteria 4580
52 JGI24698J34947_10002277 3300002449 Bacteria 10300
53 JGI24695J34938_10002492 3300002450 Bacteria 14008
54 Ga0072941_1009731 3300005201 Bacteria 23467
55 Ga0072941_1063995 3300005201 Bacteria 6367
56 Ga0072941_1137438 3300005201 Bacteria 5331
57 Ga0466721_318431 3300042608 Bacteria 4483
58 Ga0264413_116292 3300024493 Bacteria 15643
59 Ga0466693_002405 3300042592 Bacteria 54310
60 Ga0123356_10023190 3300010049 Bacteria 5845
61 Ga0123353_10540197 3300010167 Bacteria 1685
62 Ga0466731_370659 3300042622 Bacteria 3366
63 Ga0466702_229243 3300042635 Bacteria 14965
64 Ga0466702_390828 3300042635 Bacteria 3037
65 JGI24698J34947_10004849 3300002449 Bacteria 7363
66 Ga0072941_1080542 3300005201 Bacteria 5077
67 Ga0466720_193677 3300042607 Bacteria 15489
68 Ga0466722_186252 3300042609 Bacteria 5477
69 Ga0466698_154780 3300042610 Bacteria 2743
70 Ga0264413_125962 3300024493 Bacteria 10124
71 Ga0415639_147509 3300038395 Bacteria 5438
72 Ga0123356_10004241 3300010049 Bacteria 14836
73 Ga0123356_10007032 3300010049 Bacteria 11284
74 Ga0123356_10008249 3300010049 Unclassified 10366
75 Ga0466718_012848 3300042617 Bacteria 2730
76 AustNasuHG_c1000544 3300000089 Bacteria 13234
77 JGI24698J34947_10005776 3300002449 Bacteria 6785
78 JGI24698J34947_10008424 3300002449 Bacteria 5663
79 JGI24695J34938_10001007 3300002450 Bacteria 25572
80 Ga0072941_1114516 3300005201 Bacteria 2344
81 Ga0466720_151681 3300042607 Bacteria 4698
82 Ga0264413_100418 3300024493 Bacteria 17878
83 Ga0466694_103890 3300042594 Bacteria 33875
84 Ga0466694_197691 3300042594 Bacteria 23512
85 Ga0466699_059908 3300042597 Unclassified 9948
86 Ga0123356_10003652 3300010049 Bacteria 16035
87 Ga0123356_10031872 3300010049 Bacteria 4932
88 Ga0466712_179692 3300042614 Bacteria 22785
89 Ga0466718_011036 3300042617 Bacteria 3204
90 Ga0466731_012920 3300042622 Bacteria 154202
91 AustNasuHG_c1018509 3300000089 Bacteria 2297
92 JGI24695J34938_10002563 3300002450 Bacteria 13699
93 Ga0466720_176035 3300042607 Bacteria 8542
94 Ga0466720_211375 3300042607 Bacteria 60841
95 Ga0466722_014388 3300042609 Bacteria 2821
96 Ga0466690_041288 3300042590 Unclassified 13207
97 Ga0466694_234801 3300042594 Bacteria 9927
98 Ga0123353_10017028 3300010167 Bacteria 10656
99 Ga0466712_054107 3300042614 Bacteria 23105
100 Ga0466715_338079 3300042616 Bacteria 13937
101 Ga0466718_097017 3300042617 Bacteria 2013
102 Ga0466702_141232 3300042635 Bacteria 3197
103 JGI24698J34947_10000737 3300002449 Bacteria 16128
104 JGI24698J34947_10027031 3300002449 Bacteria 3045
105 JGI24695J34938_10000034 3300002450 Bacteria 102252
106 JGI24695J34938_10000990 3300002450 Bacteria 25802
107 JGI24695J34938_10002408 3300002450 Bacteria 14365
108 JGI24695J34938_10006408 3300002450 Bacteria 7077
109 Ga0072941_1013839 3300005201 Bacteria 8231
110 Ga0072941_1061086 3300005201 Bacteria 8981
111 Ga0466720_001662 3300042607 Bacteria 11322
112 Ga0466722_014187 3300042609 Bacteria 6361
113 Ga0264413_100040 3300024493 Bacteria 17360
114 Ga0466692_169787 3300042591 Bacteria 6728
115 Ga0466693_165874 3300042592 Unclassified 7773

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10355469 Ga0123353_103554692 424
2 3300005201 Ga0072941_1137438 Ga0072941_11374387 438
3 3300005201 Ga0072941_1014673 Ga0072941_10146731 443
4 3300010049 Ga0123356_10003652 Ga0123356_100036529 445
5 3300042635 Ga0466702_197588 Ga0466702_197588_23318_24751 445
6 iso_pr_bacteria 2820020240 2820021008 451
7 3300042597 Ga0466699_103536 Ga0466699_103536_4880_6370 453
8 3300042597 Ga0466699_439518 Ga0466699_439518_266_1789 453
9 3300002450 JGI24695J34938_10001318 JGI24695J34938_100013185 457
10 3300005201 Ga0072941_1009731 Ga0072941_100973115 459
11 3300010049 Ga0123356_10050087 Ga0123356_100500872 464
12 3300042617 Ga0466718_095301 Ga0466718_095301_19334_20818 464
13 3300024493 Ga0264413_104053 Ga0264413_10405314 465
14 3300038395 Ga0415639_072901 Ga0415639_072901_4165_5625 465
15 3300042614 Ga0466712_297429 Ga0466712_297429_10_1440 465
16 3300010167 Ga0123353_10540197 Ga0123353_105401971 466
17 3300038395 Ga0415639_147509 Ga0415639_147509_3610_5112 466
18 3300002449 JGI24698J34947_10014153 JGI24698J34947_100141535 467
19 3300010049 Ga0123356_10000125 Ga0123356_1000012529 467
20 3300042616 Ga0466715_338079 Ga0466715_338079_4943_6526 467
21 3300042622 Ga0466731_388856 Ga0466731_388856_1205_2668 467
22 3300042617 Ga0466718_091361 Ga0466718_091361_89_1531 469
23 3300042608 Ga0466721_318431 Ga0466721_318431_369_1898 471
24 3300042614 Ga0466712_074391 Ga0466712_074391_1735_3189 471
25 3300042592 Ga0466693_002405 Ga0466693_002405_16053_17513 472
26 3300010049 Ga0123356_10007032 Ga0123356_100070321 473
27 3300024493 Ga0264413_100418 Ga0264413_10041811 473
28 3300042614 Ga0466712_257317 Ga0466712_257317_6034_7503 473
29 3300042622 Ga0466731_012920 Ga0466731_012920_108490_109986 473
30 3300042594 Ga0466694_126938 Ga0466694_126938_4612_6123 474
31 3300005201 Ga0072941_1013839 Ga0072941_10138398 475
32 3300038395 Ga0415639_022188 Ga0415639_022188_6174_7640 475
33 3300010049 Ga0123356_10031872 Ga0123356_100318724 476
34 3300010167 Ga0123353_10017028 Ga0123353_100170285 476
35 3300002450 JGI24695J34938_10002563 JGI24695J34938_100025634 477
36 3300005201 Ga0072941_1061086 Ga0072941_10610862 477
37 3300010049 Ga0123356_10004241 Ga0123356_100042415 477
38 3300042597 Ga0466699_036221 Ga0466699_036221_17244_18713 477
39 3300042614 Ga0466712_179692 Ga0466712_179692_5531_6982 477
40 3300042592 Ga0466693_165874 Ga0466693_165874_1929_3410 480
41 3300042607 Ga0466720_213637 Ga0466720_213637_2674_4116 480
42 3300002449 JGI24698J34947_10002277 JGI24698J34947_100022778 481
43 3300010049 Ga0123356_10008249 Ga0123356_100082491 481
44 3300042597 Ga0466699_059908 Ga0466699_059908_5547_7070 481
45 3300042635 Ga0466702_141232 Ga0466702_141232_1321_2766 481
46 3300042635 Ga0466702_154134 Ga0466702_154134_11346_12791 481
47 3300002450 JGI24695J34938_10002408 JGI24695J34938_100024086 482
48 3300042593 Ga0466691_070342 Ga0466691_070342_1064_2725 482
49 3300002450 JGI24695J34938_10001007 JGI24695J34938_1000100714 483
50 3300042635 Ga0466702_390828 Ga0466702_390828_1090_2541 483
51 3300005201 Ga0072941_1014704 Ga0072941_10147041 484
52 3300005201 Ga0072941_1114516 Ga0072941_11145162 484
53 3300042614 Ga0466712_054107 Ga0466712_054107_7611_9065 484
54 3300042617 Ga0466718_108588 Ga0466718_108588_866_2320 484
55 3300002449 JGI24698J34947_10004849 JGI24698J34947_100048493 485
56 3300002449 JGI24698J34947_10027031 JGI24698J34947_100270312 485
57 3300042614 Ga0466712_022565 Ga0466712_022565_5499_6956 485
58 3300042614 Ga0466712_101890 Ga0466712_101890_3965_5422 485
59 3300002449 JGI24698J34947_10000295 JGI24698J34947_1000029513 486
60 3300002449 JGI24698J34947_10013755 JGI24698J34947_100137554 486
61 3300042590 Ga0466690_041288 Ga0466690_041288_6426_8009 486
62 3300042591 Ga0466692_055727 Ga0466692_055727_3337_4878 486
63 3300005201 Ga0072941_1063995 Ga0072941_10639957 487
64 3300042594 Ga0466694_055897 Ga0466694_055897_11654_13117 487
65 iso_pr_bacteria 2781125648 2781305675 487
66 3300010049 Ga0123356_10023190 Ga0123356_100231902 488
67 iso_pr_bacteria 2781125642 2781292453 488
68 3300002450 JGI24695J34938_10000990 JGI24695J34938_1000099018 489
69 3300002450 JGI24695J34938_10002492 JGI24695J34938_100024929 489
70 3300042591 Ga0466692_169787 Ga0466692_169787_4303_5814 489
71 3300042635 Ga0466702_024190 Ga0466702_024190_423_1892 489
72 3300002449 JGI24698J34947_10002125 JGI24698J34947_100021252 490
73 3300042607 Ga0466720_193677 Ga0466720_193677_13107_14579 490
74 3300005485 Ga0074263_114015 Ga0074263_1140152 491
75 3300042594 Ga0466694_197691 Ga0466694_197691_15115_16590 491
76 3300042597 Ga0466699_414897 Ga0466699_414897_467_1942 491
77 3300024493 Ga0264413_116292 Ga0264413_1162923 492
78 iso_pr_bacteria 2781125660 2781330927 492
79 3300042594 Ga0466694_322816 Ga0466694_322816_10967_12511 493
80 3300042618 Ga0466723_022467 Ga0466723_022467_5061_6644 493
81 3300042656 Ga0466732_091318 Ga0466732_091318_4865_6349 494
82 3300042594 Ga0466694_103890 Ga0466694_103890_10006_11523 495
83 3300042617 Ga0466718_097017 Ga0466718_097017_346_1887 495
84 iso_pr_bacteria 2781125636 2781280076 495
85 iso_pr_bacteria 2781125646 2781300457 495
86 3300002450 JGI24695J34938_10000034 JGI24695J34938_1000003447 496
87 3300005201 Ga0072941_1044264 Ga0072941_10442647 496
88 iso_pr_bacteria 2781125638 2781284362 496
89 3300000089 AustNasuHG_c1000544 AustNasuHG_100054410 497
90 3300042591 Ga0466692_117410 Ga0466692_117410_5347_6963 497
91 iso_pr_bacteria 2819992462 2819994419 497
92 3300002450 JGI24695J34938_10006408 JGI24695J34938_100064086 498
93 3300042607 Ga0466720_036827 Ga0466720_036827_2259_3782 498
94 3300000089 AustNasuHG_c1018509 AustNasuHG_10185092 499
95 3300024493 Ga0264413_125962 Ga0264413_1259626 499
96 3300042607 Ga0466720_039534 Ga0466720_039534_4343_5842 499
97 3300042609 Ga0466722_014187 Ga0466722_014187_144_1763 499
98 3300042609 Ga0466722_014388 Ga0466722_014388_644_2224 499
99 3300042622 Ga0466731_370659 Ga0466731_370659_62_1561 499
100 3300042607 Ga0466720_176035 Ga0466720_176035_5162_6691 500
101 3300002449 JGI24698J34947_10000737 JGI24698J34947_1000073710 501
102 3300042656 Ga0466732_159474 Ga0466732_159474_2590_4140 501
103 iso_pr_bacteria 2781125659 2781328067 502
104 3300042594 Ga0466694_034645 Ga0466694_034645_1232_2743 503
105 3300042635 Ga0466702_229243 Ga0466702_229243_4693_6204 503
106 3300042617 Ga0466718_011036 Ga0466718_011036_1109_2623 504
107 3300042607 Ga0466720_001662 Ga0466720_001662_4612_6144 505
108 3300042597 Ga0466699_191805 Ga0466699_191805_6370_7893 507
109 3300002449 JGI24698J34947_10005776 JGI24698J34947_100057762 508
110 3300005201 Ga0072941_1080542 Ga0072941_10805424 508
111 3300042614 Ga0466712_271960 Ga0466712_271960_2392_3918 508
112 3300042594 Ga0466694_234801 Ga0466694_234801_4498_6030 510
113 3300024493 Ga0264413_100040 Ga0264413_1000408 511
114 3300042610 Ga0466698_154780 Ga0466698_154780_1057_2592 511
115 3300042607 Ga0466720_211375 Ga0466720_211375_13018_14556 512
116 3300005200 Ga0072940_1023808 Ga0072940_10238081 513
117 3300042609 Ga0466722_186252 Ga0466722_186252_497_2089 514
118 3300002449 JGI24698J34947_10008424 JGI24698J34947_100084244 515
119 3300042607 Ga0466720_151681 Ga0466720_151681_679_2229 516
120 3300042617 Ga0466718_012848 Ga0466718_012848_1121_2677 518
121 3300042597 Ga0466699_082500 Ga0466699_082500_12231_13793 520
122 3300042612 Ga0466705_266113 Ga0466705_266113_41041_42651 525
123 3300024493 Ga0264413_102233 Ga0264413_1022334 528
124 3300042643 Ga0466704_140178 Ga0466704_140178_15569_17179 536

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03772 Competence Competence protein 263 524 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.