Protein Family IF09384

Metagenome Isolate
148 Members
42 Samples
140 Scaffolds
353.74 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_139785|Ga0466704_139785_2034_3164
Length
376 aa
Sequence
MASCEGFHFQAGKLEKNINRIKLPLINGYFLCRRVTGIERYAIEITYRLDELSKPGELAIIIPGGTTKKTISVPAYKNIRVIRYAKMQTHACWQMLSLQLFLLTHRQYMILDFGNTCLPFAPGIIFLHDIYCEFFSDDFTSFHDKIVRLYNKWQYRLIAKRAKKIVTVSEFSKKQIAETYRIDPGRISVIYSSWNHFRMIKADYSVFEAFPALSQRQFYFSLGSLSKRKNIRWIIEYAAKHPDSCFALSGTSLPTAKIGGLDAGALGNILFLGYLDDARVKALMERCKAFVLPSYYEGFGLTPLEALSCGAKIIIANAASLPEIYGKTAHYIDPFDTNVDLDKLLQEPVESPDFILGKYSYDTAARQVYDLISGIT

📊 Sample Types

Isolate 3.4%
Metagenome 96.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Kalotermitidae 35.0%
Unclassified 12.5%
Termopsidae 7.5%
Rhinotermitidae 5.0%

🌳 Taxonomy

Archaea 1
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
15 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_120486 3300042612 Bacteria 12038
2 JGI24698J34947_10000289 3300002449 Bacteria 21802
3 JGI24700J35501_10930899 3300002508 Bacteria 36700
4 Ga0466698_209522 3300042610 Bacteria 1344
5 Ga0466712_041086 3300042614 Bacteria 62732
6 Ga0466723_041142 3300042618 Bacteria 41550
7 Ga0466723_103048 3300042618 Bacteria 13029
8 Ga0466708_280980 3300042652 Bacteria 3182
9 JGI24698J34947_10000174 3300002449 Bacteria 25056
10 JGI24698J34947_10094619 3300002449 Bacteria 1361
11 JGI24702J35022_10001440 3300002462 Bacteria 14831
12 Ga0123356_10009909 3300010049 Bacteria 9385
13 Ga0466722_132900 3300042609 Bacteria 11567
14 Ga0264413_114831 3300024493 Bacteria 3895
15 Ga0466690_092360 3300042590 Bacteria 12914
16 Ga0466691_058363 3300042593 Bacteria 17021
17 Ga0466694_086477 3300042594 Bacteria 2675
18 Ga0466696_412468 3300042596 Bacteria 2338
19 Ga0466699_088613 3300042597 Bacteria 91931
20 Ga0466712_248216 3300042614 Bacteria 3735
21 Ga0466711_058999 3300042615 Unclassified 2418
22 Ga0466711_184391 3300042615 Bacteria 3286
23 Ga0466715_003157 3300042616 Bacteria 16477
24 Ga0466715_011664 3300042616 Bacteria 6679
25 Ga0466715_351588 3300042616 Bacteria 3845
26 Ga0466723_086192 3300042618 Bacteria 4742
27 Ga0466726_146285 3300042619 Bacteria 5245
28 Ga0466726_338101 3300042619 Bacteria 3233
29 Ga0466704_139785 3300042643 Bacteria 33741
30 Ga0466704_140178 3300042643 Bacteria 60046
31 JGI24698J34947_10010906 3300002449 Bacteria 4987
32 Ga0072941_1151583 3300005201 Bacteria 4265
33 Ga0123356_10000062 3300010049 Bacteria 112695
34 Ga0466716_307533 3300042605 Unclassified 5100
35 Ga0466690_373501 3300042590 Bacteria 1936
36 Ga0466692_067481 3300042591 Bacteria 1589
37 Ga0466691_104564 3300042593 Unclassified 1366
38 Ga0466694_042050 3300042594 Unclassified 1937
39 Ga0466694_297644 3300042594 Bacteria 3309
40 Ga0466699_027583 3300042597 Unclassified 8325
41 Ga0466699_118972 3300042597 Bacteria 29522
42 Ga0466718_022853 3300042617 Bacteria 49734
43 Ga0466718_038578 3300042617 Bacteria 1670
44 Ga0466726_323095 3300042619 Bacteria 1296
45 Ga0466703_308941 3300042636 Bacteria 13319
46 Ga0466703_326039 3300042636 Bacteria 10823
47 Ga0466709_335298 3300042648 Bacteria 2965
48 Ga0466705_266113 3300042612 Bacteria 67009
49 AustNasuHG_c1000438 3300000089 Bacteria 14574
50 JGI24698J34947_10013919 3300002449 Unclassified 4385
51 JGI24695J34938_10010235 3300002450 Bacteria 5155
52 Ga0123356_10137416 3300010049 Bacteria 2405
53 Ga0466720_041453 3300042607 Bacteria 36391
54 Ga0466722_043926 3300042609 Bacteria 6065
55 Ga0466692_002945 3300042591 Bacteria 6301
56 Ga0466691_025139 3300042593 Bacteria 13400
57 Ga0466705_488839 3300042612 Bacteria 2826
58 Ga0466711_396298 3300042615 Unclassified 1244
59 Ga0466711_425854 3300042615 Unclassified 1461
60 Ga0466715_062449 3300042616 Bacteria 13496
61 Ga0466723_031805 3300042618 Bacteria 21552
62 Ga0466726_083364 3300042619 Bacteria 5463
63 Ga0466726_352019 3300042619 Bacteria 1918
64 Ga0466728_332620 3300042620 Unclassified 1979
65 Ga0466702_262535 3300042635 Bacteria 2969
66 Ga0466703_150539 3300042636 Bacteria 10863
67 Ga0466704_280972 3300042643 Bacteria 32550
68 Ga0466709_185006 3300042648 Bacteria 4066
69 Ga0466708_010650 3300042652 Bacteria 13065
70 Ga0466708_210315 3300042652 Bacteria 30080
71 Ga0466705_320840 3300042612 Bacteria 5613
72 Ga0466733_161818 3300042659 Bacteria 5882
73 JGI24702J35022_10018872 3300002462 Bacteria 3756
74 Ga0123356_10339158 3300010049 Bacteria 1623
75 Ga0466716_306769 3300042605 Unclassified 1406
76 Ga0415639_209346 3300038395 Bacteria 1906
77 Ga0466696_043537 3300042596 Bacteria 7033
78 Ga0466699_443040 3300042597 Bacteria 1957
79 Ga0466705_463000 3300042612 Bacteria 14210
80 Ga0466726_135683 3300042619 Bacteria 2292
81 Ga0466735_082530 3300042624 Bacteria 24525
82 Ga0466704_440181 3300042643 Bacteria 4342
83 Ga0466727_012783 3300042655 Archaea 1421
84 Ga0466727_037388 3300042655 Bacteria 1566
85 JGI24698J34947_10000004 3300002449 Bacteria 62550
86 JGI24698J34947_10000130 3300002449 Bacteria 27577
87 JGI24695J34938_10000122 3300002450 Bacteria 69892
88 Ga0072941_1080845 3300005201 Bacteria 2366
89 Ga0123356_10020788 3300010049 Bacteria 6207
90 Ga0123356_10239441 3300010049 Bacteria 1885
91 Ga0466716_014331 3300042605 Bacteria 9944
92 Ga0466722_012948 3300042609 Bacteria 7606
93 Ga0466722_143109 3300042609 Bacteria 4319
94 Ga0466690_420390 3300042590 Bacteria 4190
95 Ga0466694_373562 3300042594 Bacteria 1319
96 Ga0466696_055964 3300042596 Bacteria 10068
97 Ga0466712_209174 3300042614 Unclassified 5600
98 Ga0466712_307642 3300042614 Bacteria 17229
99 Ga0466711_086467 3300042615 Unclassified 2734
100 Ga0466718_028461 3300042617 Bacteria 13376
101 Ga0466728_019539 3300042620 Bacteria 2359
102 Ga0466728_160570 3300042620 Bacteria 2349
103 Ga0466709_036259 3300042648 Bacteria 16966
104 Ga0466709_322292 3300042648 Bacteria 18005
105 Ga0466708_013317 3300042652 Bacteria 15314
106 Ga0466708_439683 3300042652 Bacteria 2186
107 Ga0466732_000603 3300042656 Bacteria 2378
108 JGI24698J34947_10002693 3300002449 Bacteria 9592
109 JGI24698J34947_10055819 3300002449 Bacteria 1966
110 Ga0466722_072395 3300042609 Bacteria 3058
111 Ga0466698_302426 3300042610 Bacteria 4764
112 Ga0264413_105627 3300024493 Bacteria 18134
113 Ga0466691_142574 3300042593 Bacteria 5951
114 Ga0466699_044365 3300042597 Bacteria 1911
115 Ga0466705_420322 3300042612 Bacteria 3109
116 Ga0466712_265069 3300042614 Unclassified 3155
117 Ga0466735_000927 3300042624 Bacteria 6647
118 Ga0466703_057110 3300042636 Bacteria 12891
119 Ga0466704_454493 3300042643 Bacteria 1260
120 Ga0466708_048655 3300042652 Unclassified 1924
121 Ga0466732_008658 3300042656 Bacteria 11160
122 Ga0466732_020860 3300042656 Bacteria 2916
123 JGI24698J34947_10004750 3300002449 Bacteria 7424
124 JGI24695J34938_10000004 3300002450 Bacteria 163071
125 JGI24695J34938_10040994 3300002450 Bacteria 2081
126 Ga0072941_1004185 3300005201 Bacteria 50030
127 Ga0072941_1188500 3300005201 Bacteria 1924
128 Ga0466719_457231 3300042606 Bacteria 1883
129 Ga0466720_037586 3300042607 Bacteria 39008
130 Ga0466720_211375 3300042607 Bacteria 60841
131 Ga0466720_214432 3300042607 Bacteria 1865
132 Ga0466722_255419 3300042609 Bacteria 3278
133 Ga0466691_139169 3300042593 Bacteria 8795
134 Ga0466712_020273 3300042614 Bacteria 6228
135 Ga0466712_022976 3300042614 Bacteria 24268
136 Ga0466712_185745 3300042614 Bacteria 7374
137 Ga0466728_076796 3300042620 Bacteria 3162
138 Ga0466728_126886 3300042620 Bacteria 10469
139 Ga0466728_162912 3300042620 Bacteria 6237
140 Ga0466704_215651 3300042643 Bacteria 22801

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_420390 Ga0466690_420390_2085_3056 323
2 3300042615 Ga0466711_058999 Ga0466711_058999_1125_2099 324
3 3300042609 Ga0466722_255419 Ga0466722_255419_2287_3264 325
4 3300042615 Ga0466711_086467 Ga0466711_086467_464_1444 326
5 3300042656 Ga0466732_020860 Ga0466732_020860_238_1293 326
6 3300038395 Ga0415639_209346 Ga0415639_209346_892_1878 328
7 3300042617 Ga0466718_028461 Ga0466718_028461_4084_5148 328
8 3300042607 Ga0466720_211375 Ga0466720_211375_45348_46406 332
9 3300042594 Ga0466694_373562 Ga0466694_373562_122_1138 338
10 3300002449 JGI24698J34947_10000174 JGI24698J34947_1000017416 341
11 3300002449 JGI24698J34947_10055819 JGI24698J34947_100558192 341
12 3300042609 Ga0466722_043926 Ga0466722_043926_4502_5575 341
13 3300005201 Ga0072941_1004185 Ga0072941_100418516 343
14 3300042612 Ga0466705_463000 Ga0466705_463000_12909_13949 346
15 3300042591 Ga0466692_002945 Ga0466692_002945_303_1379 347
16 3300042594 Ga0466694_042050 Ga0466694_042050_152_1237 347
17 3300042648 Ga0466709_322292 Ga0466709_322292_1289_2353 347
18 3300042597 Ga0466699_088613 Ga0466699_088613_68485_69534 349
19 3300042614 Ga0466712_185745 Ga0466712_185745_4917_5969 350
20 3300042652 Ga0466708_280980 Ga0466708_280980_1109_2176 350
21 3300002449 JGI24698J34947_10004750 JGI24698J34947_100047502 351
22 3300002449 JGI24698J34947_10010906 JGI24698J34947_100109063 351
23 3300042594 Ga0466694_086477 Ga0466694_086477_763_1818 351
24 3300042607 Ga0466720_214432 Ga0466720_214432_629_1684 351
25 3300042610 Ga0466698_209522 Ga0466698_209522_85_1140 351
26 3300042612 Ga0466705_266113 Ga0466705_266113_24590_25645 351
27 3300042614 Ga0466712_041086 Ga0466712_041086_30474_31529 351
28 3300042643 Ga0466704_140178 Ga0466704_140178_32576_33631 351
29 iso_pr_bacteria 2781125644 2781294876 351
30 3300002450 JGI24695J34938_10000004 JGI24695J34938_10000004108 352
31 3300005201 Ga0072941_1080845 Ga0072941_10808452 352
32 3300042590 Ga0466690_092360 Ga0466690_092360_8075_9133 352
33 3300042597 Ga0466699_118972 Ga0466699_118972_10404_11462 352
34 3300042605 Ga0466716_307533 Ga0466716_307533_555_1613 352
35 3300042607 Ga0466720_041453 Ga0466720_041453_16544_17602 352
36 3300042618 Ga0466723_031805 Ga0466723_031805_823_1881 352
37 3300042643 Ga0466704_215651 Ga0466704_215651_19880_20938 352
38 3300042652 Ga0466708_048655 Ga0466708_048655_37_1095 352
39 3300002449 JGI24698J34947_10000130 JGI24698J34947_1000013012 353
40 3300002449 JGI24698J34947_10000289 JGI24698J34947_1000028910 353
41 3300002449 JGI24698J34947_10094619 JGI24698J34947_100946191 353
42 3300002462 JGI24702J35022_10018872 JGI24702J35022_100188722 353
43 3300024493 Ga0264413_105627 Ga0264413_10562714 353
44 3300042610 Ga0466698_302426 Ga0466698_302426_2928_3989 353
45 3300042614 Ga0466712_020273 Ga0466712_020273_264_1325 353
46 3300042618 Ga0466723_041142 Ga0466723_041142_12210_13271 353
47 3300042618 Ga0466723_086192 Ga0466723_086192_538_1599 353
48 3300042636 Ga0466703_326039 Ga0466703_326039_5986_7047 353
49 3300042643 Ga0466704_454493 Ga0466704_454493_114_1175 353
50 3300042659 Ga0466733_161818 Ga0466733_161818_4558_5619 353
51 3300002450 JGI24695J34938_10040994 JGI24695J34938_100409942 354
52 3300002462 JGI24702J35022_10001440 JGI24702J35022_1000144010 354
53 3300005201 Ga0072941_1151583 Ga0072941_11515832 354
54 3300042593 Ga0466691_142574 Ga0466691_142574_2069_3133 354
55 3300042597 Ga0466699_044365 Ga0466699_044365_809_1873 354
56 3300042597 Ga0466699_443040 Ga0466699_443040_767_1831 354
57 3300042609 Ga0466722_072395 Ga0466722_072395_1136_2200 354
58 3300042612 Ga0466705_420322 Ga0466705_420322_1710_2774 354
59 3300042612 Ga0466705_488839 Ga0466705_488839_1496_2560 354
60 3300042614 Ga0466712_209174 Ga0466712_209174_1216_2280 354
61 3300042614 Ga0466712_248216 Ga0466712_248216_329_1393 354
62 3300042614 Ga0466712_265069 Ga0466712_265069_983_2047 354
63 3300042619 Ga0466726_083364 Ga0466726_083364_492_1556 354
64 3300042636 Ga0466703_308941 Ga0466703_308941_5601_6665 354
65 3300042652 Ga0466708_013317 Ga0466708_013317_13405_14469 354
66 3300042652 Ga0466708_210315 Ga0466708_210315_21036_22100 354
67 iso_pr_bacteria 2819994798 2819998146 354
68 3300002449 JGI24698J34947_10002693 JGI24698J34947_100026934 355
69 3300002449 JGI24698J34947_10013919 JGI24698J34947_100139192 355
70 3300002450 JGI24695J34938_10010235 JGI24695J34938_100102353 355
71 3300002508 JGI24700J35501_10930899 JGI24700J35501_109308999 355
72 3300042593 Ga0466691_104564 Ga0466691_104564_44_1111 355
73 3300042605 Ga0466716_014331 Ga0466716_014331_4336_5403 355
74 3300042605 Ga0466716_306769 Ga0466716_306769_50_1117 355
75 3300042609 Ga0466722_012948 Ga0466722_012948_5629_6696 355
76 3300042612 Ga0466705_120486 Ga0466705_120486_595_1662 355
77 3300042612 Ga0466705_320840 Ga0466705_320840_494_1561 355
78 3300042615 Ga0466711_425854 Ga0466711_425854_323_1390 355
79 3300042620 Ga0466728_126886 Ga0466728_126886_9191_10258 355
80 3300042643 Ga0466704_280972 Ga0466704_280972_2591_3658 355
81 3300042643 Ga0466704_440181 Ga0466704_440181_3214_4281 355
82 3300042648 Ga0466709_036259 Ga0466709_036259_15772_16839 355
83 3300042648 Ga0466709_185006 Ga0466709_185006_2775_3842 355
84 3300042648 Ga0466709_335298 Ga0466709_335298_911_1978 355
85 3300042652 Ga0466708_010650 Ga0466708_010650_11678_12745 355
86 3300042655 Ga0466727_037388 Ga0466727_037388_170_1237 355
87 3300000089 AustNasuHG_c1000438 AustNasuHG_10004381 356
88 3300042593 Ga0466691_058363 Ga0466691_058363_3714_4784 356
89 3300042593 Ga0466691_139169 Ga0466691_139169_6649_7719 356
90 3300042594 Ga0466694_297644 Ga0466694_297644_507_1577 356
91 3300042614 Ga0466712_307642 Ga0466712_307642_12762_13832 356
92 3300042616 Ga0466715_011664 Ga0466715_011664_766_1836 356
93 3300042619 Ga0466726_338101 Ga0466726_338101_1502_2572 356
94 3300042624 Ga0466735_082530 Ga0466735_082530_14192_15262 356
95 3300042635 Ga0466702_262535 Ga0466702_262535_726_1796 356
96 3300042636 Ga0466703_057110 Ga0466703_057110_6577_7647 356
97 3300042652 Ga0466708_439683 Ga0466708_439683_973_2043 356
98 3300042655 Ga0466727_012783 Ga0466727_012783_318_1388 356
99 3300005201 Ga0072941_1188500 Ga0072941_11885002 357
100 3300010049 Ga0123356_10009909 Ga0123356_100099095 357
101 3300010049 Ga0123356_10137416 Ga0123356_101374163 357
102 3300024493 Ga0264413_114831 Ga0264413_1148312 357
103 3300042596 Ga0466696_043537 Ga0466696_043537_2308_3381 357
104 3300042596 Ga0466696_055964 Ga0466696_055964_4817_5890 357
105 3300042606 Ga0466719_457231 Ga0466719_457231_131_1204 357
106 3300042609 Ga0466722_143109 Ga0466722_143109_1041_2114 357
107 3300042618 Ga0466723_103048 Ga0466723_103048_3815_4888 357
108 3300042619 Ga0466726_323095 Ga0466726_323095_106_1179 357
109 3300042620 Ga0466728_019539 Ga0466728_019539_18_1091 357
110 3300042620 Ga0466728_160570 Ga0466728_160570_1169_2242 357
111 3300042636 Ga0466703_150539 Ga0466703_150539_4450_5523 357
112 3300042656 Ga0466732_000603 Ga0466732_000603_572_1645 357
113 iso_pr_bacteria 2819992462 2819994656 357
114 3300002449 JGI24698J34947_10000004 JGI24698J34947_1000000437 358
115 3300042591 Ga0466692_067481 Ga0466692_067481_402_1478 358
116 3300042609 Ga0466722_132900 Ga0466722_132900_3553_4629 358
117 3300042619 Ga0466726_135683 Ga0466726_135683_528_1604 358
118 3300042619 Ga0466726_146285 Ga0466726_146285_352_1428 358
119 3300042624 Ga0466735_082530 Ga0466735_082530_13126_14202 358
120 iso_pr_bacteria 2781125660 2781330246 358
121 3300010049 Ga0123356_10000062 Ga0123356_1000006239 359
122 3300010049 Ga0123356_10020788 Ga0123356_100207886 359
123 3300042590 Ga0466690_373501 Ga0466690_373501_595_1674 359
124 3300042593 Ga0466691_025139 Ga0466691_025139_3802_4881 359
125 3300042596 Ga0466696_412468 Ga0466696_412468_43_1122 359
126 3300042615 Ga0466711_396298 Ga0466711_396298_30_1109 359
127 3300042616 Ga0466715_351588 Ga0466715_351588_2490_3569 359
128 3300042620 Ga0466728_162912 Ga0466728_162912_4184_5263 359
129 3300042624 Ga0466735_000927 Ga0466735_000927_179_1258 359
130 3300042597 Ga0466699_027583 Ga0466699_027583_4409_5491 360
131 3300042617 Ga0466718_022853 Ga0466718_022853_35982_37064 360
132 3300042620 Ga0466728_076796 Ga0466728_076796_1942_3024 360
133 3300042656 Ga0466732_008658 Ga0466732_008658_38_1120 360
134 3300042607 Ga0466720_037586 Ga0466720_037586_1137_2222 361
135 3300042616 Ga0466715_062449 Ga0466715_062449_10102_11187 361
136 3300002450 JGI24695J34938_10000122 JGI24695J34938_1000012220 362
137 3300042616 Ga0466715_003157 Ga0466715_003157_6431_7519 362
138 3300010049 Ga0123356_10239441 Ga0123356_102394412 363
139 3300042620 Ga0466728_332620 Ga0466728_332620_362_1453 363
140 3300042624 Ga0466735_082530 Ga0466735_082530_15255_16346 363
141 iso_pr_bacteria 2781125692 2781430922 363
142 3300042617 Ga0466718_038578 Ga0466718_038578_259_1353 364
143 3300002449 JGI24698J34947_10000174 JGI24698J34947_1000017417 365
144 3300042615 Ga0466711_184391 Ga0466711_184391_263_1360 365
145 3300010049 Ga0123356_10339158 Ga0123356_103391583 366
146 3300042619 Ga0466726_352019 Ga0466726_352019_767_1870 367
147 3300042614 Ga0466712_022976 Ga0466712_022976_21213_22328 371
148 3300042643 Ga0466704_139785 Ga0466704_139785_2034_3164 376

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00534 Glycos_transf_1 Glycosyl transferases group 1 214 327 0.91
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 221 336 0.83
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 122 191 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00534 GO:0016757 glycosyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.