Protein Family IF09379

Metagenome Isolate
157 Members
57 Samples
150 Scaffolds
110.76 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_133648|Ga0466704_133648_1487_1888
Length
133 aa
Sequence
MEDSTMTELSKDKLIEAISSLSIIELSELVKALEEKFGVSALAPTVMAAASTTNVVAADVVEEKTEFNVILTSIGASKINVIKVVREITGLGLKEAKDLVDGAPNIVKDNISKSEAEEIKKKLIEVGASVELK

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 25.5%
Unclassified 12.7%
Apidae 7.3%
Passalidae 5.5%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Armadillidiidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 29

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
2 3300000475 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 Metagenome Apidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
12 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 8101255641 Snodgrassella sp. M0110 Isolate Apidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
28 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
32 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
45 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
46 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
47 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
49 2849406737 Snodgrassella alvi PEB0178 Isolate Apidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
52 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_084105 3300042612 Bacteria 1813
2 Ga0123353_10068371 3300010167 Bacteria 5704
3 Ga0123353_10286049 3300010167 Bacteria 2528
4 Ga0123353_10514364 3300010167 Bacteria 1739
5 Ga0123353_12934075 3300010167 Bacteria 554
6 Ga0466711_157262 3300042615 Bacteria 14003
7 Ga0466715_391873 3300042616 Bacteria 1048
8 Ga0466726_152950 3300042619 Unclassified 15247
9 Ga0466726_338996 3300042619 Bacteria 5681
10 Ga0466726_387681 3300042619 Bacteria 2019
11 Ga0466690_218913 3300042590 Unclassified 6452
12 Ga0466695_040425 3300042595 Bacteria 7890
13 Ga0466696_015286 3300042596 Bacteria 9512
14 Ga0466706_065083 3300042599 Bacteria 14584
15 Ga0466716_356472 3300042605 Unclassified 6812
16 Ga0466698_101504 3300042610 Bacteria 11573
17 Ga0466703_268703 3300042636 Bacteria 10389
18 Ga0466708_025171 3300042652 Unclassified 34338
19 Ga0466727_189108 3300042655 Bacteria 11877
20 2227538697 2225789004 Bacteria 611
21 HBC_ctgsDRAFT_1026477 3300000333 Unclassified 1423
22 Ga0068305_10001727 3300005083 Unclassified 3711
23 Ga0068305_10002005 3300005083 Unclassified 14847
24 Ga0466705_041236 3300042612 Bacteria 17123
25 Ga0123357_10038458 3300009784 Bacteria 6514
26 Ga0123355_11280059 3300009826 Bacteria 738
27 Ga0123356_10328030 3300010049 Bacteria 1646
28 Ga0123353_12618954 3300010167 Bacteria 596
29 Ga0466715_394436 3300042616 Bacteria 12319
30 Ga0466726_142158 3300042619 Bacteria 14266
31 Ga0466726_424887 3300042619 Bacteria 1061
32 Ga0466726_439357 3300042619 Bacteria 2076
33 Ga0466729_048527 3300042621 Bacteria 1981
34 Ga0264413_150896 3300024493 Bacteria 4121
35 Ga0466691_023000 3300042593 Bacteria 2095
36 Ga0466713_088138 3300042602 Bacteria 12525
37 Ga0466716_132168 3300042605 Bacteria 13249
38 Ga0466735_232979 3300042624 Bacteria 1997
39 Ga0466703_019759 3300042636 Bacteria 14140
40 Ga0466704_212386 3300042643 Unclassified 2263
41 Ga0466727_194661 3300042655 Bacteria 11133
42 IMNBL1DRAFT_c0025046 3300000062 Unclassified 2296
43 JGI24695J34938_10145618 3300002450 Bacteria 969
44 Ga0466705_121833 3300042612 Bacteria 15440
45 Ga0466705_217388 3300042612 Bacteria 2491
46 Ga0466705_335260 3300042612 Unclassified 1266
47 Ga0123356_11264097 3300010049 Bacteria 902
48 Ga0160464_100196 3300012805 Bacteria 61467
49 Ga0466726_251535 3300042619 Bacteria 6616
50 Ga0466726_336815 3300042619 Bacteria 12910
51 Ga0466728_341550 3300042620 Bacteria 38650
52 Ga0466696_377181 3300042596 Bacteria 59848
53 Ga0466706_260282 3300042599 Bacteria 2803
54 Ga0466707_058122 3300042601 Bacteria 23469
55 Ga0466714_050092 3300042603 Bacteria 43548
56 Ga0466735_074310 3300042624 Bacteria 1284
57 Ga0466703_348168 3300042636 Bacteria 8397
58 Ga0466708_181389 3300042652 Bacteria 30464
59 Ga0466727_224885 3300042655 Bacteria 1447
60 JGI24696J40584_12959989 3300002834 Bacteria 6039
61 Ga0466705_133380 3300042612 Unclassified 1651
62 Ga0466705_145690 3300042612 Bacteria 3469
63 Ga0123353_10446121 3300010167 Bacteria 1907
64 Ga0123353_11018714 3300010167 Bacteria 1110
65 Ga0466729_038902 3300042621 Bacteria 3855
66 Ga0466657_350508 3300042582 Bacteria 2543
67 Ga0466706_178199 3300042599 Bacteria 1971
68 Ga0466713_005670 3300042602 Bacteria 17868
69 Ga0466714_166528 3300042603 Unclassified 1879
70 Ga0466716_254877 3300042605 Unclassified 10681
71 Ga0466722_180033 3300042609 Bacteria 17185
72 Ga0466722_183214 3300042609 Bacteria 1202
73 Ga0466704_084114 3300042643 Unclassified 2485
74 Ga0466704_133648 3300042643 Bacteria 13774
75 Ga0466704_438042 3300042643 Bacteria 2104
76 Ga0466709_141443 3300042648 Unclassified 14099
77 Ga0466709_409593 3300042648 Bacteria 3368
78 Ga0466727_198286 3300042655 Bacteria 11166
79 JGI24702J35022_10000366 3300002462 Bacteria 26831
80 Ga0123357_10045950 3300009784 Bacteria 5923
81 Ga0123356_10222717 3300010049 Bacteria 1944
82 Ga0123353_10164343 3300010167 Bacteria 3530
83 Ga0123353_11115384 3300010167 Unclassified 1046
84 Ga0466726_181241 3300042619 Bacteria 1036
85 Ga0466726_286056 3300042619 Bacteria 2142
86 Ga0466728_454406 3300042620 Bacteria 14071
87 Ga0160445_102461 3300012847 Bacteria 4258
88 Ga0466701_101169 3300042598 Bacteria 66668
89 Ga0466714_009901 3300042603 Bacteria 2670
90 Ga0466719_486404 3300042606 Unclassified 1144
91 Ga0466735_142045 3300042624 Bacteria 10879
92 Ga0466703_179910 3300042636 Unclassified 14152
93 Ga0466704_152759 3300042643 Unclassified 1698
94 Ga0466727_088208 3300042655 Bacteria 1756
95 Ga0466727_215359 3300042655 Bacteria 55489
96 2227480184 2225789004 Bacteria 78831
97 IMNBGM34_c000336 3300000036 Bacteria 13553
98 IMNBL1DRAFT_c0013585 3300000062 Bacteria 3642
99 JGI24698J34947_10000093 3300002449 Bacteria 30040
100 Ga0068305_10010491 3300005083 Bacteria 4121
101 Ga0123353_10495908 3300010167 Bacteria 1781
102 Ga0123353_13358657 3300010167 Bacteria 509
103 Ga0466715_119678 3300042616 Bacteria 6351
104 Ga0466715_422059 3300042616 Unclassified 2836
105 Ga0466723_001143 3300042618 Bacteria 2368
106 Ga0466723_208580 3300042618 Bacteria 2274
107 Ga0456237_0023978 3300041968 Bacteria 834
108 Ga0466691_127193 3300042593 Bacteria 1941
109 Ga0466696_100303 3300042596 Bacteria 2835
110 Ga0466713_109379 3300042602 Bacteria 40861
111 Ga0466719_042228 3300042606 Bacteria 1134
112 Ga0466719_103466 3300042606 Unclassified 5223
113 Ga0466719_110883 3300042606 Bacteria 3405
114 Ga0466721_186390 3300042608 Bacteria 7274
115 Ga0466722_024827 3300042609 Bacteria 13981
116 Ga0466704_522060 3300042643 Unclassified 1092
117 Ga0466708_323940 3300042652 Bacteria 18001
118 Ga0123356_10021554 3300010049 Unclassified 6081
119 Ga0123354_10356467 3300010882 Unclassified 1296
120 Ga0466715_118917 3300042616 Bacteria 13975
121 Ga0466726_075076 3300042619 Bacteria 15349
122 Ga0466728_330508 3300042620 Bacteria 20092
123 Ga0466729_002566 3300042621 Unclassified 2914
124 Ga0466694_328893 3300042594 Unclassified 1623
125 Ga0466716_100238 3300042605 Bacteria 2154
126 Ga0466719_138180 3300042606 Bacteria 3204
127 Ga0466735_008246 3300042624 Bacteria 2418
128 Ga0466709_209507 3300042648 Bacteria 6668
129 Ga0466708_045890 3300042652 Bacteria 13303
130 Ga0466708_183984 3300042652 Bacteria 148491
131 JGI24705J35276_12235773 3300002504 Bacteria 6966
132 JGI24705J35276_12238355 3300002504 Unclassified 19870
133 Ga0068305_10001856 3300005083 Bacteria 7094
134 Ga0466705_056233 3300042612 Bacteria 3521
135 Ga0123354_10453992 3300010882 Bacteria 1035
136 Ga0466711_093162 3300042615 Bacteria 19638
137 Ga0466711_412363 3300042615 Unclassified 14157
138 Ga0466715_044590 3300042616 Bacteria 10561
139 Ga0466728_327386 3300042620 Unclassified 17345
140 Ga0160468_115093 3300012819 Bacteria 702
141 Ga0466690_410627 3300042590 Bacteria 3708
142 Ga0466691_055990 3300042593 Bacteria 16255
143 Ga0466696_031843 3300042596 Bacteria 9420
144 Ga0466707_093501 3300042601 Bacteria 14748
145 Ga0466707_251895 3300042601 Bacteria 2613
146 Ga0466716_212757 3300042605 Bacteria 1979
147 Ga0466735_144860 3300042624 Bacteria 2862
148 Ga0466703_249168 3300042636 Bacteria 12929
149 SCG598J21_11573 3300000475 Bacteria 13732
150 JGI24702J35022_10061098 3300002462 Bacteria 2015

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10045950 Ga0123357_100459508 98
2 3300010049 Ga0123356_10021554 Ga0123356_100215543 99
3 3300010049 Ga0123356_11264097 Ga0123356_112640971 99
4 3300042648 Ga0466709_409593 Ga0466709_409593_2359_2736 99
5 3300012819 Ga0160468_115093 Ga0160468_1150931 101
6 2225789004 2227480184 2227939008 102
7 3300010167 Ga0123353_10068371 Ga0123353_100683714 102
8 3300012847 Ga0160445_102461 Ga0160445_1024612 102
9 3300042612 Ga0466705_084105 Ga0466705_084105_631_1008 102
10 3300042643 Ga0466704_152759 Ga0466704_152759_1052_1429 102
11 3300000062 IMNBL1DRAFT_c0025046 IMNBL1DRAFT_00250462 103
12 3300002504 JGI24705J35276_12235773 JGI24705J35276_1223577310 103
13 3300042608 Ga0466721_186390 Ga0466721_186390_2142_2519 103
14 3300042619 Ga0466726_439357 Ga0466726_439357_1005_1379 103
15 3300042652 Ga0466708_045890 Ga0466708_045890_5527_5904 103
16 3300002462 JGI24702J35022_10061098 JGI24702J35022_100610982 104
17 3300042590 Ga0466690_218913 Ga0466690_218913_1628_2005 104
18 3300042593 Ga0466691_055990 Ga0466691_055990_4513_4890 104
19 3300042599 Ga0466706_065083 Ga0466706_065083_8208_8585 104
20 3300042603 Ga0466714_009901 Ga0466714_009901_281_661 104
21 3300042605 Ga0466716_100238 Ga0466716_100238_134_511 104
22 3300042612 Ga0466705_056233 Ga0466705_056233_3070_3447 104
23 3300042620 Ga0466728_341550 Ga0466728_341550_11101_11475 104
24 3300042624 Ga0466735_142045 Ga0466735_142045_2636_3010 104
25 3300042652 Ga0466708_025171 Ga0466708_025171_22163_22537 104
26 3300010167 Ga0123353_10446121 Ga0123353_104461212 105
27 3300010167 Ga0123353_13358657 Ga0123353_133586571 105
28 3300042596 Ga0466696_015286 Ga0466696_015286_8874_9251 105
29 3300042605 Ga0466716_132168 Ga0466716_132168_9663_10037 105
30 3300042606 Ga0466719_103466 Ga0466719_103466_4294_4671 105
31 3300042612 Ga0466705_335260 Ga0466705_335260_548_925 105
32 3300042615 Ga0466711_157262 Ga0466711_157262_7768_8145 105
33 3300042616 Ga0466715_044590 Ga0466715_044590_5685_6062 105
34 3300042616 Ga0466715_394436 Ga0466715_394436_4048_4416 105
35 3300042616 Ga0466715_422059 Ga0466715_422059_769_1146 105
36 3300042620 Ga0466728_327386 Ga0466728_327386_8401_8778 105
37 3300042620 Ga0466728_454406 Ga0466728_454406_8313_8690 105
38 3300042655 Ga0466727_215359 Ga0466727_215359_30579_30956 105
39 3300042593 Ga0466691_127193 Ga0466691_127193_11_388 106
40 3300042605 Ga0466716_254877 Ga0466716_254877_8638_9015 106
41 3300042636 Ga0466703_019759 Ga0466703_019759_5529_5906 106
42 3300000333 HBC_ctgsDRAFT_1026477 HBC_ctgsDRAFT_10264771 107
43 3300002450 JGI24695J34938_10145618 JGI24695J34938_101456182 107
44 3300002834 JGI24696J40584_12959989 JGI24696J40584_129599892 107
45 3300042595 Ga0466695_040425 Ga0466695_040425_5508_5888 107
46 3300042598 Ga0466701_101169 Ga0466701_101169_41409_41774 107
47 3300042601 Ga0466707_093501 Ga0466707_093501_12587_12976 107
48 3300042605 Ga0466716_356472 Ga0466716_356472_1266_1652 107
49 3300042606 Ga0466719_110883 Ga0466719_110883_1162_1545 107
50 3300042606 Ga0466719_138180 Ga0466719_138180_2070_2441 107
51 3300042609 Ga0466722_024827 Ga0466722_024827_4881_5258 107
52 3300042615 Ga0466711_093162 Ga0466711_093162_11845_12219 107
53 3300042616 Ga0466715_119678 Ga0466715_119678_2578_2955 107
54 3300042619 Ga0466726_181241 Ga0466726_181241_652_1026 107
55 3300042621 Ga0466729_038902 Ga0466729_038902_2190_2573 107
56 3300042624 Ga0466735_144860 Ga0466735_144860_1229_1606 107
57 3300042648 Ga0466709_141443 Ga0466709_141443_12519_12893 107
58 3300005083 Ga0068305_10010491 Ga0068305_100104912 108
59 3300009784 Ga0123357_10038458 Ga0123357_100384588 108
60 3300009826 Ga0123355_11280059 Ga0123355_112800591 108
61 3300010167 Ga0123353_10286049 Ga0123353_102860492 108
62 3300010167 Ga0123353_11115384 Ga0123353_111153841 108
63 3300010167 Ga0123353_12934075 Ga0123353_129340751 108
64 3300010882 Ga0123354_10356467 Ga0123354_103564672 108
65 3300042582 Ga0466657_350508 Ga0466657_350508_2058_2447 108
66 3300042590 Ga0466690_410627 Ga0466690_410627_3215_3592 108
67 3300042596 Ga0466696_377181 Ga0466696_377181_54460_54837 108
68 3300042602 Ga0466713_005670 Ga0466713_005670_3088_3465 108
69 3300042603 Ga0466714_050092 Ga0466714_050092_36826_37212 108
70 3300042603 Ga0466714_166528 Ga0466714_166528_1243_1623 108
71 3300042606 Ga0466719_486404 Ga0466719_486404_379_753 108
72 3300042619 Ga0466726_251535 Ga0466726_251535_1996_2373 108
73 3300042620 Ga0466728_330508 Ga0466728_330508_2720_3112 108
74 3300042636 Ga0466703_249168 Ga0466703_249168_9457_9834 108
75 3300042636 Ga0466703_268703 Ga0466703_268703_5517_5894 108
76 3300042652 Ga0466708_323940 Ga0466708_323940_3779_4156 108
77 3300002504 JGI24705J35276_12238355 JGI24705J35276_122383556 109
78 3300010167 Ga0123353_10164343 Ga0123353_101643432 109
79 3300042602 Ga0466713_109379 Ga0466713_109379_39315_39695 109
80 3300042606 Ga0466719_042228 Ga0466719_042228_153_536 109
81 3300042619 Ga0466726_336815 Ga0466726_336815_3266_3637 109
82 3300042619 Ga0466726_338996 Ga0466726_338996_3366_3740 109
83 3300042624 Ga0466735_008246 Ga0466735_008246_1517_1900 109
84 3300042636 Ga0466703_179910 Ga0466703_179910_12249_12623 109
85 3300042643 Ga0466704_212386 Ga0466704_212386_543_929 109
86 3300002462 JGI24702J35022_10000366 JGI24702J35022_1000036611 110
87 3300010167 Ga0123353_10514364 Ga0123353_105143644 110
88 3300012805 Ga0160464_100196 Ga0160464_10019621 110
89 3300041968 Ga0456237_0023978 Ga0456237_0023978_38_421 110
90 3300042601 Ga0466707_058122 Ga0466707_058122_520_891 110
91 3300042609 Ga0466722_180033 Ga0466722_180033_7615_7992 110
92 3300042612 Ga0466705_133380 Ga0466705_133380_1153_1554 110
93 3300042612 Ga0466705_217388 Ga0466705_217388_1425_1802 110
94 3300042615 Ga0466711_412363 Ga0466711_412363_12243_12647 110
95 3300042619 Ga0466726_142158 Ga0466726_142158_1412_1798 110
96 3300042624 Ga0466735_074310 Ga0466735_074310_162_554 110
97 3300042643 Ga0466704_522060 Ga0466704_522060_15_416 110
98 3300000062 IMNBL1DRAFT_c0013585 IMNBL1DRAFT_00135852 111
99 3300002449 JGI24698J34947_10000093 JGI24698J34947_1000009327 111
100 3300005083 Ga0068305_10002005 Ga0068305_100020054 111
101 3300010882 Ga0123354_10453992 Ga0123354_104539921 111
102 3300042593 Ga0466691_023000 Ga0466691_023000_564_965 111
103 3300042596 Ga0466696_031843 Ga0466696_031843_8104_8481 111
104 3300042605 Ga0466716_212757 Ga0466716_212757_536_910 111
105 3300042616 Ga0466715_391873 Ga0466715_391873_398_772 111
106 3300042618 Ga0466723_208580 Ga0466723_208580_168_554 111
107 3300042621 Ga0466729_002566 Ga0466729_002566_1601_1978 111
108 3300042643 Ga0466704_084114 Ga0466704_084114_1048_1434 111
109 3300042655 Ga0466727_088208 Ga0466727_088208_1400_1735 111
110 3300042655 Ga0466727_198286 Ga0466727_198286_1217_1600 111
111 3300042612 Ga0466705_121833 Ga0466705_121833_13584_13976 112
112 3300042616 Ga0466715_118917 Ga0466715_118917_11960_12349 112
113 3300042618 Ga0466723_001143 Ga0466723_001143_246_647 112
114 3300042619 Ga0466726_075076 Ga0466726_075076_1168_1551 112
115 3300042619 Ga0466726_152950 Ga0466726_152950_2191_2568 112
116 3300042619 Ga0466726_387681 Ga0466726_387681_1424_1795 112
117 3300042624 Ga0466735_232979 Ga0466735_232979_506_883 112
118 3300042636 Ga0466703_348168 Ga0466703_348168_4225_4599 112
119 3300042655 Ga0466727_194661 Ga0466727_194661_2856_3227 112
120 3300000475 SCG598J21_11573 SCG598J21_115737 113
121 3300010049 Ga0123356_10328030 Ga0123356_103280302 113
122 3300042594 Ga0466694_328893 Ga0466694_328893_154_540 113
123 3300010167 Ga0123353_10495908 Ga0123353_104959081 114
124 3300042601 Ga0466707_251895 Ga0466707_251895_1684_2055 114
125 3300042610 Ga0466698_101504 Ga0466698_101504_3156_3542 114
126 3300042652 Ga0466708_183984 Ga0466708_183984_71018_71446 114
127 3300042602 Ga0466713_088138 Ga0466713_088138_9850_10242 115
128 3300005083 Ga0068305_10001727 Ga0068305_100017274 116
129 3300010167 Ga0123353_12618954 Ga0123353_126189541 116
130 3300042612 Ga0466705_145690 Ga0466705_145690_2430_2834 117
131 3300042621 Ga0466729_048527 Ga0466729_048527_1260_1652 117
132 3300042643 Ga0466704_438042 Ga0466704_438042_695_1063 117
133 2225789004 2227538697 2228058621 118
134 3300000036 IMNBGM34_c000336 IMNBGM34_0003365 119
135 3300042596 Ga0466696_100303 Ga0466696_100303_37_402 121
136 3300024493 Ga0264413_150896 Ga0264413_1508965 122
137 3300042619 Ga0466726_286056 Ga0466726_286056_1146_1514 122
138 3300042648 Ga0466709_209507 Ga0466709_209507_3971_4339 122
139 3300042652 Ga0466708_181389 Ga0466708_181389_5588_5956 122
140 iso_pr_bacteria 2820141685 2820142752 122
141 iso_pr_bacteria 2849406737 2849407492 123
142 iso_pr_bacteria 8101255641 8101255887 123
143 3300010049 Ga0123356_10222717 Ga0123356_102227172 125
144 iso_pr_bacteria 2820748953 2820749633 125
145 3300010167 Ga0123353_11018714 Ga0123353_110187142 126
146 3300042655 Ga0466727_224885 Ga0466727_224885_28_408 126
147 iso_pr_bacteria 2772190892 2773436557 126
148 3300042619 Ga0466726_424887 Ga0466726_424887_473_856 127
149 iso_pr_bacteria 2529293168 2531451562 127
150 3300042609 Ga0466722_183214 Ga0466722_183214_466_852 128
151 3300042655 Ga0466727_189108 Ga0466727_189108_10909_11295 128
152 iso_pr_bacteria 2772190894 2773439262 128
153 3300042612 Ga0466705_041236 Ga0466705_041236_3535_3924 129
154 3300042599 Ga0466706_178199 Ga0466706_178199_362_757 131
155 3300042599 Ga0466706_260282 Ga0466706_260282_1195_1590 131
156 3300005083 Ga0068305_10001856 Ga0068305_100018564 132
157 3300042643 Ga0466704_133648 Ga0466704_133648_1487_1888 133

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain 67 133 0.99
PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain 11 50 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.51 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.