Protein Family IF09375

Metagenome Isolate
107 Members
38 Samples
102 Scaffolds
202.71 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_128283|Ga0466704_128283_3869_4576
Length
235 aa
Sequence
LNYALPKLVCPCIITNILAIGLYKKNCKEIFTMNSIVKAGAAVFFALLLFASCSSSPKVTRIDSGSQVDLSGLWNDTDVRIVCDSLIKACLDSPRVTQEIARRGGIPTVQVGSFRNESDEHIDTSIISSTMEVAIFNSGKLDFVAGGDTRNELRVERQEQQGNASEATAAALGNETGADFLLTGSVKTIIDRAGGTATRTYFVSAEMTNIETNARMWMDQNSEIKKYIQTPKAKL

📊 Sample Types

Isolate 4.7%
Metagenome 95.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 26.3%
Unclassified 18.4%
Rhinotermitidae 10.5%
Termopsidae 7.9%

🌳 Taxonomy

Archaea 1
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10003757 3300002449 Bacteria 8271
2 Ga0072940_1158595 3300005200 Bacteria 3716
3 Ga0466692_104910 3300042591 Bacteria 6792
4 Ga0466709_012606 3300042648 Bacteria 2429
5 Ga0466727_133754 3300042655 Unclassified 2191
6 Ga0466707_310847 3300042601 Bacteria 1049
7 Ga0466719_070755 3300042606 Bacteria 2975
8 Ga0466719_433634 3300042606 Bacteria 3509
9 Ga0466719_510591 3300042606 Bacteria 4781
10 Ga0466722_070398 3300042609 Bacteria 15856
11 Ga0466712_283178 3300042614 Bacteria 1273
12 Ga0466726_307884 3300042619 Bacteria 2935
13 Ga0466728_125823 3300042620 Bacteria 7252
14 Ga0123356_11185665 3300010049 Bacteria 930
15 Ga0466690_011060 3300042590 Bacteria 2088
16 Ga0466691_195886 3300042593 Bacteria 9290
17 Ga0466694_036975 3300042594 Bacteria 7927
18 Ga0466705_367091 3300042612 Unclassified 1715
19 Ga0466731_126621 3300042622 Bacteria 2827
20 Ga0466704_420684 3300042643 Bacteria 2501
21 Ga0466709_014712 3300042648 Bacteria 6260
22 Ga0466708_419414 3300042652 Bacteria 2593
23 Ga0466727_069827 3300042655 Bacteria 4546
24 Ga0466712_258583 3300042614 Bacteria 1117
25 Ga0466715_534778 3300042616 Bacteria 25308
26 Ga0466728_386654 3300042620 Bacteria 1392
27 Ga0123356_10030245 3300010049 Bacteria 5069
28 Ga0123356_10524395 3300010049 Bacteria 1343
29 Ga0466696_104565 3300042596 Bacteria 9171
30 Ga0466696_135077 3300042596 Bacteria 9054
31 Ga0466703_341249 3300042636 Bacteria 6442
32 Ga0466704_243707 3300042643 Bacteria 5001
33 Ga0466708_037493 3300042652 Bacteria 10770
34 Ga0466716_331776 3300042605 Bacteria 1076
35 Ga0466712_159242 3300042614 Bacteria 52985
36 Ga0466729_031942 3300042621 Bacteria 1532
37 JGI24698J34947_10003239 3300002449 Bacteria 8819
38 JGI24695J34938_10000823 3300002450 Bacteria 28834
39 Ga0123356_10000215 3300010049 Bacteria 67385
40 Ga0456237_0007059 3300041968 Bacteria 1742
41 Ga0466696_410398 3300042596 Bacteria 2238
42 Ga0466705_029684 3300042612 Bacteria 3882
43 Ga0466703_313417 3300042636 Bacteria 2296
44 Ga0466713_138282 3300042602 Bacteria 4397
45 Ga0466716_025142 3300042605 Bacteria 1868
46 Ga0466718_006042 3300042617 Bacteria 5452
47 Ga0466723_061057 3300042618 Bacteria 6733
48 Ga0466723_165258 3300042618 Bacteria 2552
49 Ga0466728_243089 3300042620 Bacteria 5351
50 Ga0466728_281753 3300042620 Bacteria 1580
51 JGI24698J34947_10007789 3300002449 Bacteria 5883
52 Ga0123356_10000516 3300010049 Bacteria 42940
53 Ga0123356_10161348 3300010049 Bacteria 2239
54 Ga0466690_014934 3300042590 Bacteria 1209
55 Ga0466693_152700 3300042592 Bacteria 2161
56 Ga0466691_102693 3300042593 Bacteria 6107
57 Ga0466691_122726 3300042593 Bacteria 1459
58 Ga0466696_046744 3300042596 Bacteria 2488
59 Ga0466705_056354 3300042612 Bacteria 7274
60 Ga0466703_230081 3300042636 Bacteria 1059
61 Ga0466709_175814 3300042648 Bacteria 2555
62 Ga0466716_095152 3300042605 Bacteria 3596
63 Ga0466712_091910 3300042614 Bacteria 39871
64 JGI24698J34947_10008878 3300002449 Bacteria 5516
65 JGI24695J34938_10005750 3300002450 Bacteria 7641
66 Ga0123356_10000928 3300010049 Bacteria 32350
67 Ga0123356_10448105 3300010049 Bacteria 1438
68 Ga0466692_101427 3300042591 Bacteria 1941
69 Ga0466691_094253 3300042593 Bacteria 18065
70 Ga0466696_043303 3300042596 Bacteria 3453
71 Ga0466735_026473 3300042624 Bacteria 8444
72 Ga0466735_043371 3300042624 Bacteria 3113
73 Ga0466703_024213 3300042636 Bacteria 2981
74 Ga0466704_128283 3300042643 Unclassified 7416
75 Ga0466704_171502 3300042643 Bacteria 4785
76 Ga0466704_203087 3300042643 Bacteria 8736
77 Ga0466708_261574 3300042652 Bacteria 2364
78 Ga0466727_262763 3300042655 Bacteria 1482
79 Ga0466711_462329 3300042615 Bacteria 30482
80 Ga0466715_298784 3300042616 Bacteria 10278
81 Ga0466723_110434 3300042618 Bacteria 1413
82 Ga0466728_021335 3300042620 Bacteria 23979
83 Ga0123356_10347663 3300010049 Bacteria 1605
84 Ga0466729_294660 3300042621 Bacteria 1300
85 Ga0466704_314363 3300042643 Bacteria 5932
86 Ga0466727_050684 3300042655 Bacteria 1485
87 Ga0466715_318574 3300042616 Bacteria 6075
88 Ga0466718_091138 3300042617 Unclassified 4583
89 Ga0466723_008543 3300042618 Bacteria 7689
90 Ga0466723_128622 3300042618 Unclassified 5768
91 Ga0466726_237777 3300042619 Bacteria 1306
92 Ga0466728_254907 3300042620 Bacteria 4229
93 JGI24695J34938_10009155 3300002450 Bacteria 5533
94 JGI24695J34938_10009378 3300002450 Archaea 5446
95 Ga0123356_10272371 3300010049 Bacteria 1783
96 Ga0415639_019829 3300038395 Bacteria 1643
97 Ga0466691_163303 3300042593 Bacteria 4761
98 Ga0466696_183546 3300042596 Bacteria 1204
99 Ga0466705_049843 3300042612 Bacteria 8597
100 Ga0466703_300302 3300042636 Bacteria 7090
101 Ga0466708_075874 3300042652 Bacteria 7112
102 Ga0466719_508256 3300042606 Bacteria 33396

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_300302 Ga0466703_300302_6192_6716 174
2 3300042614 Ga0466712_091910 Ga0466712_091910_25727_26254 175
3 3300042620 Ga0466728_243089 Ga0466728_243089_281_910 188
4 3300005200 Ga0072940_1158595 Ga0072940_11585952 189
5 3300042618 Ga0466723_165258 Ga0466723_165258_1590_2162 190
6 3300042591 Ga0466692_101427 Ga0466692_101427_19_594 191
7 3300042616 Ga0466715_318574 Ga0466715_318574_842_1447 191
8 3300042621 Ga0466729_031942 Ga0466729_031942_46_621 191
9 3300042618 Ga0466723_128622 Ga0466723_128622_1311_1940 194
10 3300042636 Ga0466703_313417 Ga0466703_313417_1552_2139 195
11 3300042652 Ga0466708_261574 Ga0466708_261574_1367_1957 196
12 3300042596 Ga0466696_135077 Ga0466696_135077_4350_4943 197
13 3300042592 Ga0466693_152700 Ga0466693_152700_203_799 198
14 3300042619 Ga0466726_307884 Ga0466726_307884_1869_2465 198
15 iso_pr_bacteria 2781125657 2781323132 198
16 iso_pr_bacteria 2781125660 2781329928 198
17 iso_pr_bacteria 2781125661 2781333198 198
18 3300002449 JGI24698J34947_10003239 JGI24698J34947_100032393 199
19 3300002449 JGI24698J34947_10003757 JGI24698J34947_100037576 199
20 3300010049 Ga0123356_10000215 Ga0123356_1000021520 199
21 3300010049 Ga0123356_10000928 Ga0123356_100009284 199
22 3300010049 Ga0123356_10030245 Ga0123356_100302452 199
23 3300010049 Ga0123356_10347663 Ga0123356_103476632 199
24 3300042594 Ga0466694_036975 Ga0466694_036975_5075_5674 199
25 3300042614 Ga0466712_159242 Ga0466712_159242_41855_42454 199
26 3300042614 Ga0466712_283178 Ga0466712_283178_631_1230 199
27 3300042617 Ga0466718_006042 Ga0466718_006042_3429_4028 199
28 3300042648 Ga0466709_175814 Ga0466709_175814_370_1026 199
29 3300042655 Ga0466727_069827 Ga0466727_069827_3228_3827 199
30 iso_pr_bacteria 2781125662 2781336416 199
31 3300002450 JGI24695J34938_10000823 JGI24695J34938_100008238 200
32 3300010049 Ga0123356_10000516 Ga0123356_1000051632 200
33 3300041968 Ga0456237_0007059 Ga0456237_0007059_475_1077 200
34 3300042591 Ga0466692_104910 Ga0466692_104910_4759_5361 200
35 3300042614 Ga0466712_258583 Ga0466712_258583_297_899 200
36 3300042617 Ga0466718_091138 Ga0466718_091138_2557_3159 200
37 3300042622 Ga0466731_126621 Ga0466731_126621_1179_1781 200
38 3300042624 Ga0466735_026473 Ga0466735_026473_6055_6657 200
39 3300002449 JGI24698J34947_10007789 JGI24698J34947_100077894 201
40 3300002449 JGI24698J34947_10008878 JGI24698J34947_100088782 201
41 3300010049 Ga0123356_10272371 Ga0123356_102723712 201
42 3300002450 JGI24695J34938_10005750 JGI24695J34938_100057505 202
43 3300002450 JGI24695J34938_10009155 JGI24695J34938_100091553 202
44 3300002450 JGI24695J34938_10009378 JGI24695J34938_100093782 202
45 3300010049 Ga0123356_10524395 Ga0123356_105243952 202
46 3300010049 Ga0123356_11185665 Ga0123356_111856652 202
47 3300038395 Ga0415639_019829 Ga0415639_019829_132_740 202
48 3300042606 Ga0466719_070755 Ga0466719_070755_1872_2480 202
49 3300042606 Ga0466719_433634 Ga0466719_433634_1013_1621 202
50 3300042618 Ga0466723_110434 Ga0466723_110434_615_1223 202
51 3300042620 Ga0466728_125823 Ga0466728_125823_6463_7071 202
52 3300042624 Ga0466735_043371 Ga0466735_043371_570_1178 202
53 3300042636 Ga0466703_341249 Ga0466703_341249_331_939 202
54 3300042648 Ga0466709_014712 Ga0466709_014712_5494_6102 202
55 3300042652 Ga0466708_037493 Ga0466708_037493_6754_7362 202
56 iso_pr_bacteria 2781125645 2781298731 202
57 3300010049 Ga0123356_10161348 Ga0123356_101613482 203
58 3300010049 Ga0123356_10448105 Ga0123356_104481052 203
59 3300042593 Ga0466691_102693 Ga0466691_102693_5308_5919 203
60 3300042593 Ga0466691_163303 Ga0466691_163303_3732_4343 203
61 3300042593 Ga0466691_195886 Ga0466691_195886_1445_2056 203
62 3300042596 Ga0466696_046744 Ga0466696_046744_614_1225 203
63 3300042596 Ga0466696_104565 Ga0466696_104565_278_889 203
64 3300042596 Ga0466696_410398 Ga0466696_410398_116_727 203
65 3300042606 Ga0466719_510591 Ga0466719_510591_3629_4240 203
66 3300042609 Ga0466722_070398 Ga0466722_070398_4991_5602 203
67 3300042612 Ga0466705_367091 Ga0466705_367091_672_1283 203
68 3300042615 Ga0466711_462329 Ga0466711_462329_25247_25858 203
69 3300042616 Ga0466715_298784 Ga0466715_298784_8282_8893 203
70 3300042618 Ga0466723_061057 Ga0466723_061057_4519_5130 203
71 3300042619 Ga0466726_237777 Ga0466726_237777_565_1176 203
72 3300042621 Ga0466729_294660 Ga0466729_294660_334_945 203
73 3300042636 Ga0466703_024213 Ga0466703_024213_567_1178 203
74 3300042636 Ga0466703_230081 Ga0466703_230081_67_678 203
75 3300042643 Ga0466704_243707 Ga0466704_243707_2945_3556 203
76 3300042643 Ga0466704_314363 Ga0466704_314363_4401_5012 203
77 3300042643 Ga0466704_420684 Ga0466704_420684_298_909 203
78 3300042652 Ga0466708_419414 Ga0466708_419414_1618_2229 203
79 3300042655 Ga0466727_050684 Ga0466727_050684_617_1228 203
80 3300042655 Ga0466727_262763 Ga0466727_262763_809_1420 203
81 3300042643 Ga0466704_171502 Ga0466704_171502_538_1188 204
82 3300042648 Ga0466709_012606 Ga0466709_012606_1162_1776 204
83 3300042652 Ga0466708_075874 Ga0466708_075874_320_937 205
84 3300042593 Ga0466691_094253 Ga0466691_094253_7188_7814 208
85 3300042605 Ga0466716_095152 Ga0466716_095152_1843_2469 208
86 3300042605 Ga0466716_331776 Ga0466716_331776_152_778 208
87 3300042606 Ga0466719_508256 Ga0466719_508256_14914_15540 208
88 3300042590 Ga0466690_011060 Ga0466690_011060_802_1431 209
89 3300042590 Ga0466690_014934 Ga0466690_014934_221_850 209
90 3300042593 Ga0466691_122726 Ga0466691_122726_167_796 209
91 3300042596 Ga0466696_043303 Ga0466696_043303_1230_1859 209
92 3300042596 Ga0466696_183546 Ga0466696_183546_370_999 209
93 3300042616 Ga0466715_534778 Ga0466715_534778_13069_13698 209
94 3300042618 Ga0466723_008543 Ga0466723_008543_3307_3936 209
95 3300042620 Ga0466728_021335 Ga0466728_021335_14107_14736 209
96 3300042620 Ga0466728_254907 Ga0466728_254907_890_1519 209
97 3300042620 Ga0466728_386654 Ga0466728_386654_233_862 209
98 3300042643 Ga0466704_203087 Ga0466704_203087_3475_4110 211
99 3300042655 Ga0466727_133754 Ga0466727_133754_250_885 211
100 3300042601 Ga0466707_310847 Ga0466707_310847_284_922 212
101 3300042612 Ga0466705_029684 Ga0466705_029684_609_1289 213
102 3300042620 Ga0466728_281753 Ga0466728_281753_428_1072 214
103 3300042605 Ga0466716_025142 Ga0466716_025142_1010_1678 222
104 3300042612 Ga0466705_049843 Ga0466705_049843_2453_3130 225
105 3300042612 Ga0466705_056354 Ga0466705_056354_6172_6849 225
106 3300042602 Ga0466713_138282 Ga0466713_138282_2228_2932 234
107 3300042643 Ga0466704_128283 Ga0466704_128283_3869_4576 235

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13036 LpoB Peptidoglycan-synthase activator LpoB 78 221 0.94

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
1fx3-assembly1.cif.gz_D CRYSTAL STRUCTURE OF H. INFLUENZAE SECB 0.749 179 227
5t11-assembly1.cif.gz_A PelC L103M dodecamer from Paraburkholderia phytofirmans, space group C2 0.707 106 220
4q6z-assembly1.cif.gz_A LpoB C-terminal domain from Escherichia coli 0.697 78 230
5okp-assembly1.cif.gz_A Crystal structure of human SHIP2 Phosphatase-C2 double mutant F593D/L597D 0.696 201 222
5t10-assembly1.cif.gz_B PelC dodecamer from Paraburkholderia phytofirmans, space group P6 0.687 106 220
IDDescriptionScoreStartEndSuperfamily
af_Q55GU5_106_205_2.60.40.1140 Mainly Beta;Sandwich;Immunoglobulin-like;Collagen-binding surface protein Cna, B-type domain 0.7543 202 222 2.60.40.1140
af_P0A6V8_2_105_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7326 179 222 3.30.420.40
af_Q0E8C8_240_447_2.30.39.10 Mainly Beta;Roll;Alpha-1-antitrypsin; domain 1;Alpha-1-antitrypsin, domain 1 0.7318 202 224 2.30.39.10
af_F1QDF0_260_515_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.731 191 226 3.40.850.10
1yqzA03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.7033 179 224 3.30.390.30

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.