Protein Family IF09370

Metagenome Isolate
141 Members
46 Samples
136 Scaffolds
256.28 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_122710|Ga0466704_122710_1400_2290
Length
282 aa
Sequence
LQINNQKNYLSIIKLNKNTSFMETKEKTVSNKNLSKKSRGISAFVVIIVALVLAVSFFQFVLGADKNFDGGVNTAASHPINLLGTMYKGGFVVPIILTLLLTVVILSVERAFALGKAKGKGNLIQFVAVVKSHMKKGDFASAEACCTKQKGSVAAIVDAGLKKYKEMETQSLPKESKIEEIKAELEEATALELPSMQQNLPIIATLGMIKSFQALGQAGSVDSVALSVGISEALVNTACGIATGALAIISYSYFSGKIDNMTYAIDEMGFALTQTYAETHNS

📊 Sample Types

Isolate 3.5%
Metagenome 96.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.8%
Kalotermitidae 30.4%
Unclassified 15.2%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Hodotermitidae 2.2%
Blattidae 2.2%
Passalidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
22 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24699J35502_11134224 3300002509 Bacteria 74083
2 Ga0123353_10884063 3300010167 Bacteria 1219
3 Ga0123354_10000201 3300010882 Bacteria 51540
4 Ga0123354_10012939 3300010882 Bacteria 12923
5 Ga0466692_082310 3300042591 Bacteria 17927
6 Ga0466691_216055 3300042593 Unclassified 1415
7 Ga0466694_013846 3300042594 Bacteria 2853
8 Ga0466700_184271 3300042600 Bacteria 14355
9 Ga0466707_008939 3300042601 Bacteria 6269
10 Ga0466707_062128 3300042601 Bacteria 19135
11 Ga0466707_143153 3300042601 Bacteria 1999
12 Ga0466713_072155 3300042602 Bacteria 7221
13 Ga0466719_164345 3300042606 Bacteria 6286
14 Ga0466722_116341 3300042609 Bacteria 3810
15 Ga0466715_156320 3300042616 Bacteria 9972
16 Ga0466723_251298 3300042618 Bacteria 10781
17 Ga0466728_161570 3300042620 Bacteria 16747
18 Ga0466729_212978 3300042621 Bacteria 5499
19 Ga0466735_202206 3300042624 Bacteria 1681
20 Ga0466730_042453 3300042625 Bacteria 1353
21 Ga0466703_315012 3300042636 Bacteria 4143
22 Ga0466704_516628 3300042643 Bacteria 3047
23 Ga0466709_061637 3300042648 Bacteria 61213
24 Ga0466733_175458 3300042659 Bacteria 1179
25 IMNBL1DRAFT_c0003670 3300000062 Bacteria 9676
26 JGI24699J35502_11134039 3300002509 Bacteria 26006
27 Ga0123357_10000601 3300009784 Bacteria 35612
28 Ga0123357_10002054 3300009784 Bacteria 22084
29 Ga0123354_10000020 3300010882 Bacteria 127737
30 Ga0466692_104877 3300042591 Bacteria 8727
31 Ga0466691_146027 3300042593 Bacteria 15489
32 Ga0466696_393166 3300042596 Bacteria 1324
33 Ga0466701_094770 3300042598 Bacteria 17462
34 Ga0466700_026256 3300042600 Bacteria 21450
35 Ga0466707_144952 3300042601 Bacteria 11420
36 Ga0466719_305222 3300042606 Bacteria 4154
37 Ga0466722_216998 3300042609 Bacteria 4897
38 Ga0466697_169012 3300042611 Unclassified 1154
39 Ga0466735_186187 3300042624 Bacteria 5095
40 Ga0068305_10018019 3300005083 Unclassified 1696
41 Ga0123357_10027725 3300009784 Bacteria 7659
42 Ga0123357_10143989 3300009784 Unclassified 2919
43 Ga0123354_10471023 3300010882 Bacteria 1001
44 Ga0466690_103383 3300042590 Bacteria 29422
45 Ga0466707_191673 3300042601 Bacteria 8925
46 Ga0466713_000079 3300042602 Bacteria 9723
47 Ga0466719_055774 3300042606 Bacteria 1838
48 Ga0466719_335972 3300042606 Bacteria 2280
49 Ga0466726_157671 3300042619 Bacteria 25979
50 Ga0466726_275770 3300042619 Bacteria 15891
51 Ga0466705_049385 3300042612 Bacteria 4196
52 Ga0466735_134874 3300042624 Unclassified 1211
53 Ga0466703_187569 3300042636 Bacteria 2396
54 Ga0466727_050930 3300042655 Bacteria 7104
55 Ga0466727_280237 3300042655 Unclassified 2166
56 Ga0123354_10014971 3300010882 Bacteria 12087
57 Ga0123354_10226484 3300010882 Bacteria 1968
58 Ga0466656_363660 3300042550 Bacteria 3719
59 Ga0466690_002563 3300042590 Bacteria 35514
60 Ga0466692_032473 3300042591 Bacteria 22846
61 Ga0466701_070186 3300042598 Bacteria 3501
62 Ga0466700_493204 3300042600 Bacteria 1378
63 Ga0466722_236977 3300042609 Bacteria 5840
64 Ga0466698_364340 3300042610 Bacteria 1872
65 Ga0466703_064417 3300042636 Bacteria 1272
66 Ga0466703_358211 3300042636 Bacteria 2195
67 Ga0466703_412586 3300042636 Bacteria 2372
68 Ga0123354_10002580 3300010882 Bacteria 24135
69 Ga0466690_185285 3300042590 Bacteria 8561
70 Ga0466696_055511 3300042596 Bacteria 18970
71 Ga0466696_502391 3300042596 Bacteria 3344
72 Ga0466707_167533 3300042601 Bacteria 3665
73 Ga0466713_028147 3300042602 Bacteria 10334
74 Ga0466714_033452 3300042603 Bacteria 32073
75 Ga0466715_270198 3300042616 Bacteria 10479
76 Ga0466715_293034 3300042616 Bacteria 14484
77 Ga0466726_055719 3300042619 Bacteria 11749
78 Ga0466735_024861 3300042624 Bacteria 2966
79 Ga0466735_029475 3300042624 Bacteria 2418
80 Ga0466735_188474 3300042624 Bacteria 1268
81 Ga0466704_119167 3300042643 Bacteria 16466
82 Ga0466709_370050 3300042648 Bacteria 9741
83 Ga0466708_028462 3300042652 Bacteria 25947
84 Ga0466708_058588 3300042652 Bacteria 9868
85 Ga0123354_10205529 3300010882 Archaea 2148
86 Ga0466692_182457 3300042591 Bacteria 1223
87 Ga0466707_122611 3300042601 Bacteria 1652
88 Ga0466707_224426 3300042601 Bacteria 9289
89 Ga0466707_242775 3300042601 Bacteria 11468
90 Ga0466713_033394 3300042602 Bacteria 24369
91 Ga0466713_104547 3300042602 Bacteria 10003
92 Ga0466719_416939 3300042606 Bacteria 6423
93 Ga0466722_045111 3300042609 Bacteria 2942
94 Ga0466722_241244 3300042609 Unclassified 1749
95 Ga0466711_140239 3300042615 Bacteria 10795
96 Ga0466715_095476 3300042616 Bacteria 15840
97 Ga0466697_140789 3300042611 Bacteria 2371
98 Ga0466735_044630 3300042624 Bacteria 3928
99 Ga0466735_135792 3300042624 Bacteria 1208
100 Ga0466703_040225 3300042636 Bacteria 28005
101 Ga0466704_038381 3300042643 Bacteria 7986
102 Ga0466704_507270 3300042643 Bacteria 10828
103 Ga0466732_066321 3300042656 Bacteria 71309
104 JGI24702J35022_10005057 3300002462 Bacteria 7770
105 JGI24705J35276_12074192 3300002504 Bacteria 960
106 JGI24699J35502_11134213 3300002509 Bacteria 63023
107 Ga0123353_10630236 3300010167 Bacteria 1524
108 Ga0466692_035439 3300042591 Bacteria 14978
109 Ga0466706_025055 3300042599 Bacteria 8003
110 Ga0466713_082523 3300042602 Bacteria 11972
111 Ga0466713_105442 3300042602 Bacteria 1877
112 Ga0466713_106697 3300042602 Bacteria 23975
113 Ga0466714_138494 3300042603 Bacteria 7038
114 Ga0466714_148937 3300042603 Bacteria 12781
115 Ga0466716_183914 3300042605 Bacteria 8825
116 Ga0466735_111195 3300042624 Bacteria 4138
117 Ga0466703_104988 3300042636 Bacteria 39552
118 Ga0466703_353581 3300042636 Bacteria 4239
119 Ga0466727_348535 3300042655 Bacteria 11423
120 JGI24705J35276_12074242 3300002504 Bacteria 960
121 JGI24699J35502_11133687 3300002509 Bacteria 13530
122 Ga0123357_10019263 3300009784 Bacteria 9089
123 Ga0466690_075235 3300042590 Bacteria 10422
124 Ga0466691_209732 3300042593 Bacteria 8726
125 Ga0466706_284757 3300042599 Bacteria 1400
126 Ga0466713_105697 3300042602 Bacteria 1295
127 Ga0466716_141084 3300042605 Unclassified 12459
128 Ga0466719_122540 3300042606 Bacteria 9119
129 Ga0466711_242490 3300042615 Bacteria 19433
130 Ga0466723_146235 3300042618 Bacteria 16058
131 Ga0466726_244161 3300042619 Bacteria 2064
132 Ga0466729_115703 3300042621 Bacteria 5020
133 Ga0466705_351769 3300042612 Bacteria 8631
134 Ga0466735_145451 3300042624 Bacteria 2949
135 Ga0466735_234355 3300042624 Bacteria 2299
136 Ga0466704_122710 3300042643 Bacteria 12415

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_035439 Ga0466692_035439_8424_9233 230
2 3300042624 Ga0466735_234355 Ga0466735_234355_930_1739 230
3 3300042601 Ga0466707_167533 Ga0466707_167533_2282_3094 231
4 3300042602 Ga0466713_033394 Ga0466713_033394_12638_13456 233
5 3300000062 IMNBL1DRAFT_c0003670 IMNBL1DRAFT_00036708 234
6 3300042624 Ga0466735_202206 Ga0466735_202206_757_1608 234
7 3300042624 Ga0466735_024861 Ga0466735_024861_1793_2602 236
8 3300042593 Ga0466691_216055 Ga0466691_216055_24_842 239
9 3300042600 Ga0466700_026256 Ga0466700_026256_14670_15488 239
10 3300042624 Ga0466735_134874 Ga0466735_134874_325_1146 239
11 3300042550 Ga0466656_363660 Ga0466656_363660_1143_1970 240
12 3300042600 Ga0466700_184271 Ga0466700_184271_606_1430 240
13 3300009784 Ga0123357_10027725 Ga0123357_100277258 241
14 3300042609 Ga0466722_241244 Ga0466722_241244_49_873 241
15 3300042648 Ga0466709_061637 Ga0466709_061637_59725_60543 241
16 3300042611 Ga0466697_140789 Ga0466697_140789_295_1125 242
17 3300042601 Ga0466707_143153 Ga0466707_143153_211_1032 243
18 3300042602 Ga0466713_104547 Ga0466713_104547_8714_9559 243
19 3300042619 Ga0466726_275770 Ga0466726_275770_14161_14982 243
20 3300002504 JGI24705J35276_12074242 JGI24705J35276_120742421 244
21 3300042601 Ga0466707_008939 Ga0466707_008939_387_1202 244
22 3300042601 Ga0466707_062128 Ga0466707_062128_9030_9878 245
23 3300002509 JGI24699J35502_11134224 JGI24699J35502_1113422431 246
24 3300042599 Ga0466706_025055 Ga0466706_025055_5296_6087 246
25 3300009784 Ga0123357_10002054 Ga0123357_1000205419 247
26 3300010882 Ga0123354_10012939 Ga0123354_100129392 247
27 3300042602 Ga0466713_028147 Ga0466713_028147_8903_9736 247
28 3300042602 Ga0466713_072155 Ga0466713_072155_640_1473 247
29 3300042606 Ga0466719_055774 Ga0466719_055774_231_1049 247
30 3300042606 Ga0466719_335972 Ga0466719_335972_1407_2192 247
31 3300042609 Ga0466722_045111 Ga0466722_045111_402_1187 248
32 3300042611 Ga0466697_169012 Ga0466697_169012_342_1124 248
33 3300042618 Ga0466723_251298 Ga0466723_251298_4502_5320 248
34 3300042591 Ga0466692_104877 Ga0466692_104877_7781_8596 249
35 3300005083 Ga0068305_10018019 Ga0068305_100180192 250
36 3300042605 Ga0466716_141084 Ga0466716_141084_330_1148 250
37 3300042655 Ga0466727_348535 Ga0466727_348535_6436_7260 250
38 3300009784 Ga0123357_10000601 Ga0123357_100006012 251
39 3300042594 Ga0466694_013846 Ga0466694_013846_194_1024 251
40 3300042615 Ga0466711_242490 Ga0466711_242490_15093_15914 251
41 3300042624 Ga0466735_044630 Ga0466735_044630_2980_3825 251
42 3300042624 Ga0466735_188474 Ga0466735_188474_67_876 251
43 3300010167 Ga0123353_10630236 Ga0123353_106302362 252
44 3300042603 Ga0466714_033452 Ga0466714_033452_20490_21290 252
45 3300042609 Ga0466722_116341 Ga0466722_116341_2166_2951 252
46 3300042609 Ga0466722_216998 Ga0466722_216998_49_873 252
47 3300042624 Ga0466735_111195 Ga0466735_111195_2566_3384 252
48 3300042636 Ga0466703_315012 Ga0466703_315012_515_1333 252
49 3300002504 JGI24705J35276_12074192 JGI24705J35276_120741921 253
50 3300010882 Ga0123354_10205529 Ga0123354_102055292 253
51 3300010882 Ga0123354_10471023 Ga0123354_104710231 253
52 3300042590 Ga0466690_002563 Ga0466690_002563_32458_33276 253
53 3300042599 Ga0466706_284757 Ga0466706_284757_567_1379 253
54 3300042643 Ga0466704_119167 Ga0466704_119167_12630_13448 253
55 3300010882 Ga0123354_10000201 Ga0123354_1000020136 254
56 3300042601 Ga0466707_224426 Ga0466707_224426_6396_7193 255
57 3300042603 Ga0466714_138494 Ga0466714_138494_5553_6353 255
58 3300042621 Ga0466729_212978 Ga0466729_212978_1597_2415 255
59 3300009784 Ga0123357_10019263 Ga0123357_1001926310 256
60 3300042612 Ga0466705_351769 Ga0466705_351769_7159_7974 256
61 3300042620 Ga0466728_161570 Ga0466728_161570_13690_14508 256
62 3300002462 JGI24702J35022_10005057 JGI24702J35022_100050575 257
63 3300010882 Ga0123354_10000020 Ga0123354_1000002030 257
64 3300042590 Ga0466690_185285 Ga0466690_185285_6320_7126 257
65 3300042603 Ga0466714_148937 Ga0466714_148937_10340_11128 257
66 3300042636 Ga0466703_353581 Ga0466703_353581_158_976 257
67 3300042643 Ga0466704_516628 Ga0466704_516628_1282_2100 257
68 3300042652 Ga0466708_028462 Ga0466708_028462_15401_16213 257
69 3300042590 Ga0466690_075235 Ga0466690_075235_5920_6735 258
70 3300042618 Ga0466723_146235 Ga0466723_146235_1018_1836 258
71 3300042621 Ga0466729_115703 Ga0466729_115703_431_1243 258
72 3300042636 Ga0466703_187569 Ga0466703_187569_1081_1890 258
73 3300042636 Ga0466703_358211 Ga0466703_358211_425_1243 258
74 3300002509 JGI24699J35502_11133687 JGI24699J35502_1113368712 259
75 3300002509 JGI24699J35502_11134213 JGI24699J35502_111342138 259
76 3300042601 Ga0466707_191673 Ga0466707_191673_56_871 259
77 3300042610 Ga0466698_364340 Ga0466698_364340_525_1346 259
78 3300042615 Ga0466711_140239 Ga0466711_140239_7792_8604 259
79 3300042624 Ga0466735_135792 Ga0466735_135792_349_1164 259
80 3300042624 Ga0466735_145451 Ga0466735_145451_1026_1841 259
81 3300042636 Ga0466703_064417 Ga0466703_064417_159_977 259
82 3300042648 Ga0466709_370050 Ga0466709_370050_8431_9243 259
83 3300042591 Ga0466692_032473 Ga0466692_032473_7314_8129 260
84 3300042600 Ga0466700_493204 Ga0466700_493204_501_1334 260
85 3300042616 Ga0466715_156320 Ga0466715_156320_1897_2715 260
86 3300042624 Ga0466735_029475 Ga0466735_029475_879_1688 260
87 3300042656 Ga0466732_066321 Ga0466732_066321_52923_53705 260
88 3300010882 Ga0123354_10002580 Ga0123354_100025802 261
89 3300010882 Ga0123354_10014971 Ga0123354_1001497111 261
90 3300042601 Ga0466707_144952 Ga0466707_144952_2455_3267 261
91 3300042602 Ga0466713_082523 Ga0466713_082523_10693_11538 261
92 3300042606 Ga0466719_305222 Ga0466719_305222_2971_3789 261
93 3300042619 Ga0466726_157671 Ga0466726_157671_13425_14237 261
94 3300042636 Ga0466703_104988 Ga0466703_104988_7173_7988 261
95 3300042655 Ga0466727_050930 Ga0466727_050930_4109_4921 261
96 3300042659 Ga0466733_175458 Ga0466733_175458_101_931 261
97 3300042591 Ga0466692_082310 Ga0466692_082310_13627_14451 262
98 3300042593 Ga0466691_146027 Ga0466691_146027_3311_4129 262
99 3300042596 Ga0466696_055511 Ga0466696_055511_10986_11804 262
100 3300042601 Ga0466707_122611 Ga0466707_122611_697_1515 262
101 3300042612 Ga0466705_049385 Ga0466705_049385_140_955 262
102 3300042619 Ga0466726_244161 Ga0466726_244161_400_1218 262
103 3300010882 Ga0123354_10226484 Ga0123354_102264842 263
104 3300042591 Ga0466692_182457 Ga0466692_182457_107_925 263
105 3300042596 Ga0466696_502391 Ga0466696_502391_716_1531 263
106 3300042601 Ga0466707_242775 Ga0466707_242775_10521_11339 263
107 3300042602 Ga0466713_000079 Ga0466713_000079_3187_4005 263
108 3300042605 Ga0466716_183914 Ga0466716_183914_2837_3652 263
109 3300042616 Ga0466715_293034 Ga0466715_293034_5432_6247 263
110 3300042643 Ga0466704_038381 Ga0466704_038381_5484_6299 263
111 3300042643 Ga0466704_507270 Ga0466704_507270_3846_4661 263
112 3300042652 Ga0466708_058588 Ga0466708_058588_337_1164 263
113 iso_pr_bacteria 2820789850 2820790690 263
114 3300042606 Ga0466719_122540 Ga0466719_122540_8262_9077 264
115 3300042593 Ga0466691_209732 Ga0466691_209732_2426_3247 265
116 3300042598 Ga0466701_094770 Ga0466701_094770_3809_4696 265
117 3300042602 Ga0466713_105442 Ga0466713_105442_964_1788 265
118 3300042602 Ga0466713_105697 Ga0466713_105697_382_1206 265
119 3300042606 Ga0466719_416939 Ga0466719_416939_3398_4243 265
120 3300042616 Ga0466715_270198 Ga0466715_270198_3680_4498 265
121 3300042619 Ga0466726_055719 Ga0466726_055719_4739_5566 265
122 3300042624 Ga0466735_186187 Ga0466735_186187_776_1615 265
123 3300042590 Ga0466690_103383 Ga0466690_103383_21521_22321 266
124 3300002509 JGI24699J35502_11134039 JGI24699J35502_111340399 268
125 3300042596 Ga0466696_393166 Ga0466696_393166_30_857 268
126 3300042602 Ga0466713_106697 Ga0466713_106697_22534_23367 268
127 3300009784 Ga0123357_10143989 Ga0123357_101439892 269
128 3300042609 Ga0466722_236977 Ga0466722_236977_523_1359 269
129 3300042636 Ga0466703_040225 Ga0466703_040225_13903_14739 269
130 iso_pr_bacteria 2820762746 2820765001 269
131 3300042625 Ga0466730_042453 Ga0466730_042453_208_1059 271
132 3300042606 Ga0466719_164345 Ga0466719_164345_2439_3257 272
133 3300042616 Ga0466715_095476 Ga0466715_095476_3729_4547 272
134 3300042598 Ga0466701_070186 Ga0466701_070186_2278_3120 273
135 3300042655 Ga0466727_280237 Ga0466727_280237_688_1539 273
136 3300042636 Ga0466703_412586 Ga0466703_412586_304_1161 276
137 iso_pr_bacteria 2820757377 2820758454 276
138 iso_pr_bacteria 2820759988 2820762535 276
139 iso_pr_bacteria 2940216256 2940217627 278
140 3300010167 Ga0123353_10884063 Ga0123353_108840632 282
141 3300042643 Ga0466704_122710 Ga0466704_122710_1400_2290 282

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01618 MotA_ExbB MotA/TolQ/ExbB proton channel family 154 266 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.