Protein Family IF09369
Metagenome
Isolate
132
Members
44
Samples
131
Scaffolds
161.93
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_117479|Ga0466704_117479_3660_4241
- Length
- 193 aa
- Sequence
- VFTDTYKCLDVAVYCDNLGIGGDMSVPRIYLETTMFNFYHEKRTAPPYLELKAEVHRIFELIKNGEYEPYTSLYAIREIDNEKDREKRERMAALVSEYGIKILDETDEAEHLAALYVQEQAISPAWKTDAAHIAIATVSGLDFIVSLNFTHIARPWTIERVRSVNRREGYPSIGIYKPAEVLEIYEDSARLHE
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.2%
Kalotermitidae
33.3%
Termopsidae
9.5%
Unclassified
4.8%
Rhinotermitidae
4.8%
Hodotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 3 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 9 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 10 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 24 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_519489 | 3300042606 | Bacteria | 5072 |
| 2 | Ga0415639_067567 | 3300038395 | Bacteria | 9803 |
| 3 | Ga0466690_083599 | 3300042590 | Bacteria | 2545 |
| 4 | Ga0466715_640750 | 3300042616 | Bacteria | 8059 |
| 5 | Ga0466726_158565 | 3300042619 | Bacteria | 13942 |
| 6 | Ga0466728_232930 | 3300042620 | Bacteria | 8424 |
| 7 | Ga0123353_10845041 | 3300010167 | Bacteria | 1256 |
| 8 | Ga0466704_529216 | 3300042643 | Bacteria | 37695 |
| 9 | Ga0466709_176690 | 3300042648 | Bacteria | 7771 |
| 10 | Ga0466708_180693 | 3300042652 | Bacteria | 2272 |
| 11 | JGI24695J34938_10051650 | 3300002450 | Unclassified | 1797 |
| 12 | Ga0466705_234760 | 3300042612 | Bacteria | 2077 |
| 13 | Ga0466733_172668 | 3300042659 | Bacteria | 1388 |
| 14 | Ga0466714_135833 | 3300042603 | Bacteria | 1094 |
| 15 | Ga0466719_047351 | 3300042606 | Bacteria | 1211 |
| 16 | Ga0466720_031299 | 3300042607 | Bacteria | 1048 |
| 17 | Ga0466722_183922 | 3300042609 | Bacteria | 5746 |
| 18 | Ga0466696_046091 | 3300042596 | Bacteria | 2631 |
| 19 | Ga0466696_123758 | 3300042596 | Bacteria | 1197 |
| 20 | Ga0466696_395508 | 3300042596 | Bacteria | 1176 |
| 21 | Ga0466711_420964 | 3300042615 | Bacteria | 1533 |
| 22 | Ga0466715_184730 | 3300042616 | Bacteria | 5264 |
| 23 | Ga0466718_108966 | 3300042617 | Unclassified | 2053 |
| 24 | Ga0466723_014662 | 3300042618 | Bacteria | 4522 |
| 25 | Ga0466726_329461 | 3300042619 | Bacteria | 1200 |
| 26 | Ga0123353_10809346 | 3300010167 | Bacteria | 1292 |
| 27 | Ga0123353_12300382 | 3300010167 | Bacteria | 648 |
| 28 | Ga0466729_224717 | 3300042621 | Bacteria | 1943 |
| 29 | Ga0466702_124407 | 3300042635 | Bacteria | 1056 |
| 30 | Ga0466703_277347 | 3300042636 | Bacteria | 1047 |
| 31 | Ga0466709_412608 | 3300042648 | Bacteria | 1125 |
| 32 | Ga0466705_017988 | 3300042612 | Unclassified | 9831 |
| 33 | Ga0466706_007540 | 3300042599 | Bacteria | 1929 |
| 34 | Ga0466716_389486 | 3300042605 | Bacteria | 3544 |
| 35 | Ga0466722_099754 | 3300042609 | Bacteria | 1455 |
| 36 | Ga0264413_114602 | 3300024493 | Bacteria | 2818 |
| 37 | Ga0264413_144836 | 3300024493 | Bacteria | 7405 |
| 38 | Ga0415639_039246 | 3300038395 | Bacteria | 10953 |
| 39 | Ga0466690_016376 | 3300042590 | Bacteria | 1376 |
| 40 | Ga0466694_033340 | 3300042594 | Bacteria | 1042 |
| 41 | Ga0466694_361523 | 3300042594 | Bacteria | 2565 |
| 42 | Ga0466705_406048 | 3300042612 | Bacteria | 1206 |
| 43 | Ga0466715_546223 | 3300042616 | Bacteria | 5531 |
| 44 | Ga0466728_255836 | 3300042620 | Bacteria | 1621 |
| 45 | Ga0466728_280223 | 3300042620 | Bacteria | 1566 |
| 46 | Ga0123353_10557197 | 3300010167 | Bacteria | 1651 |
| 47 | Ga0466735_200720 | 3300042624 | Bacteria | 2974 |
| 48 | Ga0466704_022334 | 3300042643 | Bacteria | 3137 |
| 49 | Ga0466704_117479 | 3300042643 | Bacteria | 8889 |
| 50 | Ga0466704_182306 | 3300042643 | Bacteria | 1677 |
| 51 | Ga0466724_37398 | 3300042649 | Bacteria | 1869 |
| 52 | Ga0466708_397785 | 3300042652 | Bacteria | 1001 |
| 53 | Ga0466727_348277 | 3300042655 | Bacteria | 2013 |
| 54 | Ga0466705_083862 | 3300042612 | Bacteria | 4015 |
| 55 | Ga0466732_384915 | 3300042656 | Bacteria | 1246 |
| 56 | Ga0466706_086062 | 3300042599 | Bacteria | 2321 |
| 57 | Ga0466707_100445 | 3300042601 | Bacteria | 4908 |
| 58 | Ga0466707_352775 | 3300042601 | Bacteria | 1830 |
| 59 | Ga0466716_522906 | 3300042605 | Bacteria | 4431 |
| 60 | Ga0466719_113753 | 3300042606 | Bacteria | 2255 |
| 61 | Ga0466722_195085 | 3300042609 | Bacteria | 1057 |
| 62 | Ga0466711_446658 | 3300042615 | Bacteria | 1868 |
| 63 | Ga0466715_100522 | 3300042616 | Bacteria | 1856 |
| 64 | Ga0466715_391182 | 3300042616 | Bacteria | 13717 |
| 65 | Ga0466726_164768 | 3300042619 | Bacteria | 1606 |
| 66 | Ga0466726_407212 | 3300042619 | Bacteria | 1135 |
| 67 | Ga0466728_383978 | 3300042620 | Bacteria | 3276 |
| 68 | Ga0466735_167682 | 3300042624 | Unclassified | 1079 |
| 69 | Ga0466703_124114 | 3300042636 | Bacteria | 1518 |
| 70 | Ga0466704_491474 | 3300042643 | Bacteria | 4305 |
| 71 | Ga0466704_496955 | 3300042643 | Bacteria | 10743 |
| 72 | Ga0466727_268906 | 3300042655 | Bacteria | 1441 |
| 73 | AustNasuHG_c1006813 | 3300000089 | Bacteria | 4071 |
| 74 | JGI24698J34947_10006811 | 3300002449 | Bacteria | 6280 |
| 75 | Ga0072941_1322087 | 3300005201 | Bacteria | 531 |
| 76 | Ga0466705_019614 | 3300042612 | Bacteria | 4742 |
| 77 | Ga0466705_061117 | 3300042612 | Bacteria | 2396 |
| 78 | Ga0466705_128525 | 3300042612 | Bacteria | 1140 |
| 79 | Ga0466707_054845 | 3300042601 | Bacteria | 2074 |
| 80 | Ga0466707_172467 | 3300042601 | Unclassified | 3422 |
| 81 | Ga0415639_023605 | 3300038395 | Bacteria | 7168 |
| 82 | Ga0466694_260931 | 3300042594 | Bacteria | 1351 |
| 83 | Ga0466711_017306 | 3300042615 | Bacteria | 4738 |
| 84 | Ga0466711_017642 | 3300042615 | Bacteria | 16028 |
| 85 | Ga0466711_065571 | 3300042615 | Bacteria | 2280 |
| 86 | Ga0466726_467981 | 3300042619 | Bacteria | 2890 |
| 87 | Ga0466704_249164 | 3300042643 | Bacteria | 7441 |
| 88 | Ga0466727_078155 | 3300042655 | Bacteria | 1681 |
| 89 | Ga0466727_238612 | 3300042655 | Bacteria | 1636 |
| 90 | JGI24695J34938_10373595 | 3300002450 | Bacteria | 631 |
| 91 | Ga0072940_1201131 | 3300005200 | Bacteria | 1058 |
| 92 | Ga0466705_138441 | 3300042612 | Bacteria | 3024 |
| 93 | Ga0466705_139154 | 3300042612 | Bacteria | 1834 |
| 94 | Ga0466707_044091 | 3300042601 | Bacteria | 1020 |
| 95 | Ga0466707_283944 | 3300042601 | Bacteria | 2634 |
| 96 | Ga0466691_050954 | 3300042593 | Bacteria | 1252 |
| 97 | Ga0466691_220261 | 3300042593 | Bacteria | 2330 |
| 98 | Ga0466699_180209 | 3300042597 | Bacteria | 1577 |
| 99 | Ga0466705_523324 | 3300042612 | Archaea | 3511 |
| 100 | Ga0466711_026493 | 3300042615 | Bacteria | 1214 |
| 101 | Ga0466723_369508 | 3300042618 | Bacteria | 2564 |
| 102 | Ga0466727_167369 | 3300042655 | Bacteria | 1563 |
| 103 | Ga0466727_335478 | 3300042655 | Bacteria | 1928 |
| 104 | JGI24698J34947_10058985 | 3300002449 | Bacteria | 1898 |
| 105 | Ga0466707_097951 | 3300042601 | Bacteria | 1012 |
| 106 | Ga0466717_164380 | 3300042604 | Bacteria | 1003 |
| 107 | Ga0466719_379717 | 3300042606 | Bacteria | 6371 |
| 108 | Ga0466696_285317 | 3300042596 | Bacteria | 1272 |
| 109 | Ga0466715_589163 | 3300042616 | Bacteria | 2755 |
| 110 | Ga0466723_270509 | 3300042618 | Unclassified | 4434 |
| 111 | Ga0466726_117926 | 3300042619 | Bacteria | 1993 |
| 112 | Ga0123356_12477685 | 3300010049 | Bacteria | 649 |
| 113 | Ga0466704_347446 | 3300042643 | Bacteria | 3737 |
| 114 | Ga0466704_394709 | 3300042643 | Bacteria | 1184 |
| 115 | Ga0068302_10066453 | 3300005071 | Unclassified | 1368 |
| 116 | Ga0466705_166758 | 3300042612 | Bacteria | 1049 |
| 117 | Ga0466705_329089 | 3300042612 | Bacteria | 2715 |
| 118 | Ga0466707_062013 | 3300042601 | Bacteria | 3377 |
| 119 | Ga0415639_045139 | 3300038395 | Bacteria | 15120 |
| 120 | Ga0415639_194201 | 3300038395 | Bacteria | 1158 |
| 121 | Ga0466691_011613 | 3300042593 | Bacteria | 1009 |
| 122 | Ga0466696_385897 | 3300042596 | Bacteria | 1000 |
| 123 | Ga0466728_060046 | 3300042620 | Bacteria | 2535 |
| 124 | Ga0466729_043610 | 3300042621 | Bacteria | 1613 |
| 125 | Ga0466729_102658 | 3300042621 | Bacteria | 1305 |
| 126 | Ga0123357_10006385 | 3300009784 | Bacteria | 14366 |
| 127 | Ga0123355_10000065 | 3300009826 | Bacteria | 113109 |
| 128 | Ga0466729_256524 | 3300042621 | Bacteria | 2209 |
| 129 | Ga0466735_118569 | 3300042624 | Bacteria | 1473 |
| 130 | Ga0466703_354078 | 3300042636 | Bacteria | 2314 |
| 131 | JGI24695J34938_10104509 | 3300002450 | Bacteria | 1156 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042617 | Ga0466718_108966 | Ga0466718_108966_1373_1771 | 132 |
| 2 | 3300024493 | Ga0264413_144836 | Ga0264413_1448364 | 141 |
| 3 | 3300042619 | Ga0466726_117926 | Ga0466726_117926_1375_1806 | 143 |
| 4 | 3300005071 | Ga0068302_10066453 | Ga0068302_100664533 | 144 |
| 5 | 3300042609 | Ga0466722_183922 | Ga0466722_183922_3535_3975 | 146 |
| 6 | 3300042612 | Ga0466705_061117 | Ga0466705_061117_1497_1937 | 146 |
| 7 | 3300042659 | Ga0466733_172668 | Ga0466733_172668_323_763 | 146 |
| 8 | 3300042619 | Ga0466726_158565 | Ga0466726_158565_2018_2461 | 147 |
| 9 | 3300042603 | Ga0466714_135833 | Ga0466714_135833_207_653 | 148 |
| 10 | 3300042636 | Ga0466703_354078 | Ga0466703_354078_98_544 | 148 |
| 11 | 3300042649 | Ga0466724_37398 | Ga0466724_37398_777_1223 | 148 |
| 12 | 3300042616 | Ga0466715_589163 | Ga0466715_589163_541_990 | 149 |
| 13 | 3300042594 | Ga0466694_361523 | Ga0466694_361523_1513_1965 | 150 |
| 14 | 3300042612 | Ga0466705_523324 | Ga0466705_523324_1239_1691 | 150 |
| 15 | 3300009784 | Ga0123357_10006385 | Ga0123357_1000638516 | 151 |
| 16 | 3300010167 | Ga0123353_10845041 | Ga0123353_108450413 | 151 |
| 17 | 3300010049 | Ga0123356_12477685 | Ga0123356_124776852 | 153 |
| 18 | 3300038395 | Ga0415639_067567 | Ga0415639_067567_8081_8545 | 154 |
| 19 | 3300042597 | Ga0466699_180209 | Ga0466699_180209_490_954 | 154 |
| 20 | 3300042601 | Ga0466707_097951 | Ga0466707_097951_76_543 | 155 |
| 21 | 3300042636 | Ga0466703_277347 | Ga0466703_277347_385_852 | 155 |
| 22 | 3300042648 | Ga0466709_412608 | Ga0466709_412608_586_1053 | 155 |
| 23 | 3300002450 | JGI24695J34938_10104509 | JGI24695J34938_101045092 | 156 |
| 24 | iso_pr_bacteria | 2820584674 | 2820585219 | 156 |
| 25 | 3300009826 | Ga0123355_10000065 | Ga0123355_1000006555 | 157 |
| 26 | 3300038395 | Ga0415639_194201 | Ga0415639_194201_436_909 | 157 |
| 27 | 3300042604 | Ga0466717_164380 | Ga0466717_164380_126_599 | 157 |
| 28 | 3300042615 | Ga0466711_446658 | Ga0466711_446658_767_1240 | 157 |
| 29 | 3300042655 | Ga0466727_268906 | Ga0466727_268906_751_1224 | 157 |
| 30 | 3300042593 | Ga0466691_220261 | Ga0466691_220261_491_967 | 158 |
| 31 | 3300042601 | Ga0466707_352775 | Ga0466707_352775_259_735 | 158 |
| 32 | 3300042615 | Ga0466711_065571 | Ga0466711_065571_417_893 | 158 |
| 33 | 3300042620 | Ga0466728_255836 | Ga0466728_255836_981_1457 | 158 |
| 34 | 3300042648 | Ga0466709_176690 | Ga0466709_176690_2559_3035 | 158 |
| 35 | 3300042655 | Ga0466727_078155 | Ga0466727_078155_99_575 | 158 |
| 36 | 3300038395 | Ga0415639_023605 | Ga0415639_023605_5444_5923 | 159 |
| 37 | 3300042593 | Ga0466691_011613 | Ga0466691_011613_256_735 | 159 |
| 38 | 3300042612 | Ga0466705_329089 | Ga0466705_329089_1669_2148 | 159 |
| 39 | 3300042616 | Ga0466715_640750 | Ga0466715_640750_552_1031 | 159 |
| 40 | 3300042621 | Ga0466729_256524 | Ga0466729_256524_272_751 | 159 |
| 41 | 3300002449 | JGI24698J34947_10058985 | JGI24698J34947_100589852 | 160 |
| 42 | 3300010167 | Ga0123353_12300382 | Ga0123353_123003821 | 160 |
| 43 | 3300042593 | Ga0466691_050954 | Ga0466691_050954_116_598 | 160 |
| 44 | 3300042601 | Ga0466707_062013 | Ga0466707_062013_2592_3074 | 160 |
| 45 | 3300042605 | Ga0466716_389486 | Ga0466716_389486_2815_3297 | 160 |
| 46 | 3300042612 | Ga0466705_128525 | Ga0466705_128525_552_1034 | 160 |
| 47 | 3300042612 | Ga0466705_166758 | Ga0466705_166758_297_779 | 160 |
| 48 | 3300042616 | Ga0466715_100522 | Ga0466715_100522_962_1444 | 160 |
| 49 | 3300042618 | Ga0466723_270509 | Ga0466723_270509_602_1084 | 160 |
| 50 | 3300042624 | Ga0466735_167682 | Ga0466735_167682_376_858 | 160 |
| 51 | 3300042636 | Ga0466703_124114 | Ga0466703_124114_530_1012 | 160 |
| 52 | 3300042655 | Ga0466727_238612 | Ga0466727_238612_650_1132 | 160 |
| 53 | 3300005201 | Ga0072941_1322087 | Ga0072941_13220871 | 161 |
| 54 | 3300010167 | Ga0123353_10557197 | Ga0123353_105571973 | 161 |
| 55 | 3300024493 | Ga0264413_114602 | Ga0264413_1146023 | 161 |
| 56 | 3300042590 | Ga0466690_083599 | Ga0466690_083599_1555_2040 | 161 |
| 57 | 3300042594 | Ga0466694_260931 | Ga0466694_260931_773_1258 | 161 |
| 58 | 3300042596 | Ga0466696_285317 | Ga0466696_285317_537_1022 | 161 |
| 59 | 3300042596 | Ga0466696_385897 | Ga0466696_385897_199_684 | 161 |
| 60 | 3300042596 | Ga0466696_395508 | Ga0466696_395508_635_1120 | 161 |
| 61 | 3300042601 | Ga0466707_044091 | Ga0466707_044091_428_913 | 161 |
| 62 | 3300042601 | Ga0466707_054845 | Ga0466707_054845_709_1194 | 161 |
| 63 | 3300042601 | Ga0466707_100445 | Ga0466707_100445_2789_3274 | 161 |
| 64 | 3300042601 | Ga0466707_172467 | Ga0466707_172467_2448_2933 | 161 |
| 65 | 3300042607 | Ga0466720_031299 | Ga0466720_031299_166_651 | 161 |
| 66 | 3300042609 | Ga0466722_099754 | Ga0466722_099754_434_919 | 161 |
| 67 | 3300042612 | Ga0466705_019614 | Ga0466705_019614_3877_4362 | 161 |
| 68 | 3300042615 | Ga0466711_017306 | Ga0466711_017306_3865_4350 | 161 |
| 69 | 3300042615 | Ga0466711_017642 | Ga0466711_017642_7995_8480 | 161 |
| 70 | 3300042616 | Ga0466715_184730 | Ga0466715_184730_1994_2479 | 161 |
| 71 | 3300042616 | Ga0466715_391182 | Ga0466715_391182_13115_13600 | 161 |
| 72 | 3300042618 | Ga0466723_014662 | Ga0466723_014662_3765_4250 | 161 |
| 73 | 3300042619 | Ga0466726_164768 | Ga0466726_164768_732_1217 | 161 |
| 74 | 3300042619 | Ga0466726_329461 | Ga0466726_329461_236_721 | 161 |
| 75 | 3300042619 | Ga0466726_407212 | Ga0466726_407212_124_609 | 161 |
| 76 | 3300042619 | Ga0466726_467981 | Ga0466726_467981_10_495 | 161 |
| 77 | 3300042620 | Ga0466728_232930 | Ga0466728_232930_766_1251 | 161 |
| 78 | 3300042620 | Ga0466728_280223 | Ga0466728_280223_102_587 | 161 |
| 79 | 3300042621 | Ga0466729_043610 | Ga0466729_043610_972_1457 | 161 |
| 80 | 3300042621 | Ga0466729_102658 | Ga0466729_102658_300_785 | 161 |
| 81 | 3300042621 | Ga0466729_224717 | Ga0466729_224717_1011_1496 | 161 |
| 82 | 3300042624 | Ga0466735_118569 | Ga0466735_118569_506_991 | 161 |
| 83 | 3300042643 | Ga0466704_491474 | Ga0466704_491474_2733_3218 | 161 |
| 84 | 3300042655 | Ga0466727_167369 | Ga0466727_167369_713_1198 | 161 |
| 85 | 3300042655 | Ga0466727_335478 | Ga0466727_335478_201_686 | 161 |
| 86 | 3300042656 | Ga0466732_384915 | Ga0466732_384915_520_1005 | 161 |
| 87 | 3300002450 | JGI24695J34938_10051650 | JGI24695J34938_100516503 | 162 |
| 88 | 3300002450 | JGI24695J34938_10373595 | JGI24695J34938_103735951 | 162 |
| 89 | 3300042620 | Ga0466728_383978 | Ga0466728_383978_1840_2328 | 162 |
| 90 | 3300042643 | Ga0466704_249164 | Ga0466704_249164_5255_5743 | 162 |
| 91 | 3300042615 | Ga0466711_026493 | Ga0466711_026493_390_881 | 163 |
| 92 | 3300038395 | Ga0415639_039246 | Ga0415639_039246_7643_8137 | 164 |
| 93 | 3300042601 | Ga0466707_283944 | Ga0466707_283944_946_1440 | 164 |
| 94 | 3300038395 | Ga0415639_045139 | Ga0415639_045139_3365_3862 | 165 |
| 95 | 3300042599 | Ga0466706_086062 | Ga0466706_086062_1783_2289 | 168 |
| 96 | 3300042652 | Ga0466708_397785 | Ga0466708_397785_185_691 | 168 |
| 97 | 3300042599 | Ga0466706_007540 | Ga0466706_007540_185_694 | 169 |
| 98 | 3300042605 | Ga0466716_522906 | Ga0466716_522906_400_909 | 169 |
| 99 | 3300042606 | Ga0466719_379717 | Ga0466719_379717_5392_5901 | 169 |
| 100 | 3300042612 | Ga0466705_406048 | Ga0466705_406048_285_794 | 169 |
| 101 | 3300042590 | Ga0466690_016376 | Ga0466690_016376_525_1037 | 170 |
| 102 | 3300042594 | Ga0466694_033340 | Ga0466694_033340_519_1031 | 170 |
| 103 | 3300042596 | Ga0466696_123758 | Ga0466696_123758_79_591 | 170 |
| 104 | 3300042606 | Ga0466719_519489 | Ga0466719_519489_4430_4942 | 170 |
| 105 | 3300042609 | Ga0466722_195085 | Ga0466722_195085_32_544 | 170 |
| 106 | 3300042612 | Ga0466705_017988 | Ga0466705_017988_8734_9246 | 170 |
| 107 | 3300042612 | Ga0466705_083862 | Ga0466705_083862_2066_2578 | 170 |
| 108 | 3300042618 | Ga0466723_369508 | Ga0466723_369508_1607_2119 | 170 |
| 109 | 3300042635 | Ga0466702_124407 | Ga0466702_124407_342_854 | 170 |
| 110 | 3300042643 | Ga0466704_022334 | Ga0466704_022334_1296_1808 | 170 |
| 111 | 3300042643 | Ga0466704_182306 | Ga0466704_182306_751_1263 | 170 |
| 112 | 3300042643 | Ga0466704_529216 | Ga0466704_529216_15231_15743 | 170 |
| 113 | 3300000089 | AustNasuHG_c1006813 | AustNasuHG_10068136 | 171 |
| 114 | 3300010167 | Ga0123353_10809346 | Ga0123353_108093462 | 171 |
| 115 | 3300042612 | Ga0466705_138441 | Ga0466705_138441_35_550 | 171 |
| 116 | 3300042615 | Ga0466711_420964 | Ga0466711_420964_816_1331 | 171 |
| 117 | 3300042620 | Ga0466728_060046 | Ga0466728_060046_146_661 | 171 |
| 118 | 3300042643 | Ga0466704_394709 | Ga0466704_394709_32_547 | 171 |
| 119 | 3300005200 | Ga0072940_1201131 | Ga0072940_12011311 | 172 |
| 120 | 3300042596 | Ga0466696_046091 | Ga0466696_046091_132_650 | 172 |
| 121 | 3300042606 | Ga0466719_047351 | Ga0466719_047351_271_789 | 172 |
| 122 | 3300042616 | Ga0466715_546223 | Ga0466715_546223_2301_2819 | 172 |
| 123 | 3300042652 | Ga0466708_180693 | Ga0466708_180693_242_760 | 172 |
| 124 | 3300042606 | Ga0466719_113753 | Ga0466719_113753_1326_1847 | 173 |
| 125 | 3300042655 | Ga0466727_348277 | Ga0466727_348277_97_624 | 175 |
| 126 | 3300042612 | Ga0466705_234760 | Ga0466705_234760_363_893 | 176 |
| 127 | 3300002449 | JGI24698J34947_10006811 | JGI24698J34947_100068118 | 179 |
| 128 | 3300042612 | Ga0466705_139154 | Ga0466705_139154_1033_1572 | 179 |
| 129 | 3300042643 | Ga0466704_496955 | Ga0466704_496955_4024_4566 | 180 |
| 130 | 3300042624 | Ga0466735_200720 | Ga0466735_200720_136_705 | 189 |
| 131 | 3300042643 | Ga0466704_347446 | Ga0466704_347446_2907_3476 | 189 |
| 132 | 3300042643 | Ga0466704_117479 | Ga0466704_117479_3660_4241 | 193 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.