Protein Family IF09366

Metagenome Isolate
203 Members
53 Samples
194 Scaffolds
280.82 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_110295|Ga0466704_110295_1103_2113
Length
336 aa
Sequence
MLKLRSGLSPPRLHGRWEVCAKRKLRKPLSRRGNGSSPFLNFALYVILPGRGSHRQMNENWNIIIEPKRKLLDLQIRDIIRYRDLIFLFVQRDFVVQYKQTILGPLWYVINPLFSTVMYTFVFGNLANIGTDGIPFLLFYYSGTMLWTFFTGCFTNASEIFITNANIFGKVYFPRLTVPISNVFSNSIKALIQFALLMSFFIYYLINRASLSPSWYAFAFPALLIWIAALGTGMGMIISALTTKYRDLKQLVTFALGLAMYITPVVYPLSQIPGRFGWLVFVNPLSTPIELFRLWFFGAGSVTTPMILTSLAMTAAFLLLGLILFNQNERNFVDVV

📊 Sample Types

Isolate 4.4%
Metagenome 95.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.2%
Kalotermitidae 25.5%
Unclassified 21.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Passalidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 199
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
2 650716102 Treponema primitia ZAS-2 Isolate Unclassified
3 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
4 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
9 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
10 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
11 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
12 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
15 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
46 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
51 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
52 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
53 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10045040 3300010049 Bacteria 4105
2 Ga0123356_10243731 3300010049 Bacteria 1870
3 Ga0466712_112275 3300042614 Bacteria 22556
4 Ga0466712_189837 3300042614 Bacteria 23751
5 Ga0466711_231507 3300042615 Bacteria 3294
6 Ga0466711_392692 3300042615 Bacteria 4008
7 Ga0466715_142776 3300042616 Bacteria 6788
8 Ga0466718_046298 3300042617 Bacteria 49319
9 Ga0466726_164213 3300042619 Bacteria 10325
10 Ga0466726_411589 3300042619 Bacteria 1260
11 Ga0466703_005280 3300042636 Bacteria 11563
12 Ga0466703_250285 3300042636 Bacteria 4635
13 Ga0466727_187663 3300042655 Bacteria 1406
14 Ga0466720_013503 3300042607 Bacteria 19037
15 Ga0466720_139881 3300042607 Bacteria 12965
16 AustNasuHG_c1002650 3300000089 Bacteria 6460
17 AustNasuHG_c1003909 3300000089 Bacteria 5366
18 AustNasuHG_c1036359 3300000089 Bacteria 1279
19 Ga0264413_105993 3300024493 Bacteria 16145
20 Ga0466690_102306 3300042590 Bacteria 3089
21 Ga0466696_036611 3300042596 Bacteria 1478
22 Ga0466699_059019 3300042597 Archaea 16041
23 Ga0466699_088613 3300042597 Bacteria 91931
24 Ga0466699_186064 3300042597 Unclassified 12998
25 Ga0466699_261364 3300042597 Bacteria 2768
26 Ga0466699_270029 3300042597 Bacteria 1375
27 Ga0466699_284466 3300042597 Bacteria 5335
28 Ga0466705_056966 3300042612 Bacteria 1475
29 Ga0466732_280874 3300042656 Bacteria 2500
30 Ga0466732_295544 3300042656 Bacteria 4738
31 Ga0123353_10816845 3300010167 Bacteria 1284
32 Ga0466712_041086 3300042614 Bacteria 62732
33 Ga0466712_154629 3300042614 Bacteria 40642
34 Ga0466726_060061 3300042619 Bacteria 1852
35 Ga0466729_050490 3300042621 Bacteria 3885
36 Ga0466704_081910 3300042643 Bacteria 5266
37 Ga0466704_293302 3300042643 Bacteria 13326
38 Ga0466704_293873 3300042643 Bacteria 3130
39 Ga0466704_398777 3300042643 Bacteria 22916
40 Ga0466709_020463 3300042648 Bacteria 3775
41 Ga0466707_187733 3300042601 Bacteria 3898
42 Ga0466713_110798 3300042602 Bacteria 1253
43 Ga0466716_259629 3300042605 Bacteria 2839
44 Ga0466722_023448 3300042609 Bacteria 22084
45 JGI24698J34947_10076428 3300002449 Bacteria 1588
46 Ga0072941_1085276 3300005201 Bacteria 3559
47 Ga0466692_096393 3300042591 Bacteria 1729
48 Ga0466705_018346 3300042612 Bacteria 13177
49 Ga0466732_321648 3300042656 Bacteria 18449
50 Ga0466732_324392 3300042656 Bacteria 21191
51 Ga0123353_10424588 3300010167 Bacteria 1968
52 Ga0466711_248653 3300042615 Bacteria 11071
53 Ga0466711_296871 3300042615 Bacteria 3917
54 Ga0466715_431253 3300042616 Bacteria 16440
55 Ga0466718_159625 3300042617 Bacteria 1092
56 Ga0466723_079137 3300042618 Bacteria 2374
57 Ga0466735_101535 3300042624 Bacteria 1131
58 Ga0466702_034624 3300042635 Bacteria 24227
59 Ga0466704_255505 3300042643 Bacteria 1904
60 Ga0466720_145662 3300042607 Bacteria 157622
61 Ga0466720_208368 3300042607 Bacteria 9543
62 Ga0466722_119833 3300042609 Bacteria 3875
63 Ga0466698_051612 3300042610 Bacteria 1807
64 JGI24698J34947_10000210 3300002449 Bacteria 23899
65 JGI24695J34938_10031656 3300002450 Bacteria 2451
66 JGI24705J35276_12206305 3300002504 Bacteria 1718
67 Ga0072940_1013176 3300005200 Bacteria 15881
68 Ga0072941_1169186 3300005201 Bacteria 1672
69 Ga0264413_103608 3300024493 Bacteria 12718
70 Ga0264413_107963 3300024493 Bacteria 7153
71 Ga0264413_133116 3300024493 Bacteria 6927
72 Ga0466696_350222 3300042596 Bacteria 1107
73 Ga0466699_110952 3300042597 Bacteria 2558
74 Ga0466699_195069 3300042597 Bacteria 2954
75 Ga0466699_271015 3300042597 Bacteria 6485
76 Ga0123355_10000659 3300009826 Bacteria 46817
77 Ga0466715_374177 3300042616 Bacteria 8365
78 Ga0466731_245932 3300042622 Bacteria 1397
79 Ga0466704_074773 3300042643 Bacteria 34926
80 Ga0466704_110351 3300042643 Bacteria 3584
81 Ga0466707_175642 3300042601 Bacteria 1645
82 Ga0466720_046917 3300042607 Bacteria 61630
83 Ga0466720_105750 3300042607 Bacteria 1936
84 Ga0466720_108024 3300042607 Bacteria 60869
85 Ga0466722_002841 3300042609 Bacteria 8378
86 Ga0466722_137819 3300042609 Bacteria 30114
87 AustNasuHG_c1001151 3300000089 Bacteria 9491
88 AustNasuHG_c1001780 3300000089 Bacteria 7804
89 JGI24695J34938_10093506 3300002450 Bacteria 1232
90 Ga0072940_1000948 3300005200 Bacteria 22507
91 Ga0072941_1023804 3300005201 Unclassified 10962
92 Ga0072941_1048633 3300005201 Bacteria 5546
93 Ga0072941_1101477 3300005201 Unclassified 2423
94 Ga0466690_031458 3300042590 Bacteria 1328
95 Ga0466692_172189 3300042591 Bacteria 6746
96 Ga0466694_360805 3300042594 Bacteria 3370
97 Ga0466696_037451 3300042596 Bacteria 1149
98 Ga0466696_499919 3300042596 Bacteria 2673
99 Ga0466699_018975 3300042597 Bacteria 8535
100 Ga0466732_112176 3300042656 Bacteria 19030
101 Ga0123356_10000833 3300010049 Bacteria 34368
102 Ga0466712_036330 3300042614 Bacteria 18507
103 Ga0466712_147179 3300042614 Bacteria 3080
104 Ga0466711_426247 3300042615 Bacteria 1909
105 Ga0466715_156433 3300042616 Bacteria 7706
106 Ga0466718_013791 3300042617 Bacteria 36967
107 Ga0466718_029744 3300042617 Bacteria 17742
108 Ga0466723_015302 3300042618 Bacteria 1435
109 Ga0466723_157044 3300042618 Bacteria 10919
110 Ga0466726_412613 3300042619 Bacteria 2529
111 Ga0466726_430238 3300042619 Bacteria 1291
112 Ga0466704_110295 3300042643 Bacteria 8491
113 Ga0466719_249016 3300042606 Bacteria 2095
114 Ga0466719_508191 3300042606 Bacteria 9037
115 Ga0466722_054824 3300042609 Bacteria 10859
116 AustNasuHG_c1001293 3300000089 Bacteria 8987
117 JGI24695J34938_10001273 3300002450 Bacteria 22105
118 JGI24695J34938_10001457 3300002450 Bacteria 20019
119 Ga0072940_1089973 3300005200 Bacteria 5381
120 Ga0072941_1071072 3300005201 Bacteria 2921
121 Ga0264413_103609 3300024493 Bacteria 2421
122 Ga0264413_104259 3300024493 Bacteria 24164
123 Ga0466692_013737 3300042591 Bacteria 2140
124 Ga0466691_167701 3300042593 Bacteria 1990
125 Ga0466694_209526 3300042594 Bacteria 2332
126 Ga0466699_027774 3300042597 Bacteria 28809
127 Ga0466699_200327 3300042597 Bacteria 6297
128 Ga0466699_227539 3300042597 Bacteria 1004
129 Ga0466699_438035 3300042597 Bacteria 2394
130 Ga0466732_380507 3300042656 Bacteria 3543
131 Ga0466705_461230 3300042612 Bacteria 4772
132 Ga0466712_014740 3300042614 Bacteria 1669
133 Ga0466715_083104 3300042616 Bacteria 3123
134 Ga0466715_224063 3300042616 Bacteria 4620
135 Ga0466718_033853 3300042617 Bacteria 13524
136 Ga0466718_117228 3300042617 Bacteria 6709
137 Ga0466718_160911 3300042617 Bacteria 8060
138 Ga0466723_082453 3300042618 Bacteria 72592
139 Ga0466719_412865 3300042606 Bacteria 31020
140 Ga0466720_034670 3300042607 Bacteria 16588
141 Ga0466720_133222 3300042607 Bacteria 3121
142 AustNasuHG_c1000422 3300000089 Bacteria 14716
143 JGI24698J34947_10000837 3300002449 Bacteria 15430
144 JGI24698J34947_10006069 3300002449 Bacteria 6632
145 Ga0072940_1117510 3300005200 Bacteria 1584
146 Ga0415639_053094 3300038395 Bacteria 8007
147 Ga0466692_002215 3300042591 Bacteria 38338
148 Ga0466691_117958 3300042593 Bacteria 28278
149 Ga0466699_042694 3300042597 Bacteria 13384
150 Ga0466699_120425 3300042597 Bacteria 25749
151 Ga0466699_247572 3300042597 Bacteria 7070
152 Ga0466712_259151 3300042614 Bacteria 11135
153 Ga0466718_006058 3300042617 Bacteria 2156
154 Ga0466726_299720 3300042619 Bacteria 2076
155 Ga0466726_419394 3300042619 Bacteria 2110
156 Ga0466735_063117 3300042624 Bacteria 4308
157 Ga0466735_111436 3300042624 Bacteria 17607
158 Ga0466702_326945 3300042635 Bacteria 2066
159 Ga0466708_063262 3300042652 Bacteria 4188
160 Ga0466707_312745 3300042601 Bacteria 1841
161 Ga0466716_485331 3300042605 Bacteria 1521
162 Ga0466720_076663 3300042607 Bacteria 2989
163 AustNasuHG_c1015024 3300000089 Bacteria 2620
164 JGI24695J34938_10000989 3300002450 Bacteria 25804
165 Ga0072941_1169187 3300005201 Bacteria 977
166 Ga0264413_103607 3300024493 Bacteria 10123
167 Ga0264413_104713 3300024493 Bacteria 35389
168 Ga0264413_125104 3300024493 Bacteria 6411
169 Ga0466656_351002 3300042550 Bacteria 3797
170 Ga0466692_110335 3300042591 Bacteria 12834
171 Ga0466699_111287 3300042597 Bacteria 7045
172 Ga0466699_320928 3300042597 Bacteria 3749
173 Ga0466697_102561 3300042611 Bacteria 1124
174 Ga0466732_270943 3300042656 Bacteria 4078
175 Ga0466715_334080 3300042616 Bacteria 1981
176 Ga0466735_196684 3300042624 Bacteria 1794
177 Ga0466704_543240 3300042643 Bacteria 6769
178 Ga0466704_547934 3300042643 Bacteria 3088
179 Ga0466708_343355 3300042652 Bacteria 3126
180 Ga0466719_473072 3300042606 Bacteria 58828
181 Ga0466720_012895 3300042607 Bacteria 75127
182 Ga0466720_131560 3300042607 Bacteria 48024
183 Ga0466720_185900 3300042607 Bacteria 9850
184 IMNBL1DRAFT_c0026171 3300000062 Bacteria 2222
185 Ga0072940_1022040 3300005200 Bacteria 2039
186 Ga0072941_1014903 3300005201 Bacteria 2269
187 Ga0264413_137299 3300024493 Bacteria 5296
188 Ga0466692_082787 3300042591 Bacteria 11257
189 Ga0466692_184475 3300042591 Bacteria 2394
190 Ga0466691_097761 3300042593 Bacteria 7504
191 Ga0466691_105856 3300042593 Bacteria 8211
192 Ga0466699_007427 3300042597 Bacteria 23813
193 Ga0466699_187061 3300042597 Bacteria 5272
194 Ga0466699_219965 3300042597 Bacteria 10807

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_103607 Ga0264413_1036077 252
2 3300042617 Ga0466718_006058 Ga0466718_006058_629_1465 264
3 3300042617 Ga0466718_159625 Ga0466718_159625_212_1048 264
4 3300005200 Ga0072940_1089973 Ga0072940_10899734 267
5 3300042614 Ga0466712_154629 Ga0466712_154629_24973_25824 268
6 3300024493 Ga0264413_137299 Ga0264413_1372994 269
7 3300042597 Ga0466699_111287 Ga0466699_111287_3241_4089 269
8 3300042609 Ga0466722_054824 Ga0466722_054824_1488_2345 269
9 3300042593 Ga0466691_167701 Ga0466691_167701_906_1757 270
10 3300042607 Ga0466720_034670 Ga0466720_034670_9156_10019 270
11 3300042619 Ga0466726_419394 Ga0466726_419394_102_947 270
12 3300005200 Ga0072940_1013176 Ga0072940_10131762 271
13 3300005201 Ga0072941_1023804 Ga0072941_102380412 271
14 3300005201 Ga0072941_1169187 Ga0072941_11691871 271
15 3300010049 Ga0123356_10243731 Ga0123356_102437312 271
16 3300042590 Ga0466690_102306 Ga0466690_102306_310_1161 271
17 3300042607 Ga0466720_076663 Ga0466720_076663_1654_2502 271
18 3300042614 Ga0466712_259151 Ga0466712_259151_295_1143 271
19 3300042617 Ga0466718_046298 Ga0466718_046298_43530_44378 271
20 3300042597 Ga0466699_438035 Ga0466699_438035_1007_1855 272
21 3300042614 Ga0466712_014740 Ga0466712_014740_626_1474 272
22 3300042614 Ga0466712_147179 Ga0466712_147179_670_1518 272
23 3300005200 Ga0072940_1117510 Ga0072940_11175102 273
24 3300042607 Ga0466720_012895 Ga0466720_012895_65573_66436 273
25 3300042614 Ga0466712_041086 Ga0466712_041086_52073_52921 273
26 3300042656 Ga0466732_321648 Ga0466732_321648_2275_3123 273
27 3300042614 Ga0466712_189837 Ga0466712_189837_19528_20376 274
28 3300042619 Ga0466726_412613 Ga0466726_412613_1022_1846 274
29 3300042624 Ga0466735_196684 Ga0466735_196684_901_1746 274
30 3300042635 Ga0466702_034624 Ga0466702_034624_851_1675 274
31 3300002449 JGI24698J34947_10000210 JGI24698J34947_1000021019 275
32 3300002449 JGI24698J34947_10076428 JGI24698J34947_100764282 275
33 3300002450 JGI24695J34938_10093506 JGI24695J34938_100935062 275
34 3300024493 Ga0264413_103609 Ga0264413_1036093 275
35 3300042606 Ga0466719_473072 Ga0466719_473072_15422_16267 275
36 3300000089 AustNasuHG_c1015024 AustNasuHG_10150246 276
37 3300042591 Ga0466692_110335 Ga0466692_110335_11297_12145 276
38 3300042607 Ga0466720_145662 Ga0466720_145662_136292_137146 276
39 3300042597 Ga0466699_261364 Ga0466699_261364_710_1558 277
40 3300038395 Ga0415639_053094 Ga0415639_053094_2501_3337 278
41 3300042594 Ga0466694_209526 Ga0466694_209526_1023_1859 278
42 3300042597 Ga0466699_110952 Ga0466699_110952_275_1111 278
43 3300042607 Ga0466720_013503 Ga0466720_013503_11700_12536 278
44 3300042609 Ga0466722_137819 Ga0466722_137819_5834_6670 278
45 3300042612 Ga0466705_056966 Ga0466705_056966_498_1334 278
46 3300042616 Ga0466715_334080 Ga0466715_334080_26_862 278
47 3300042616 Ga0466715_374177 Ga0466715_374177_2853_3689 278
48 3300042617 Ga0466718_029744 Ga0466718_029744_3044_3880 278
49 3300042617 Ga0466718_033853 Ga0466718_033853_9861_10697 278
50 3300042624 Ga0466735_111436 Ga0466735_111436_344_1180 278
51 3300042643 Ga0466704_074773 Ga0466704_074773_33327_34163 278
52 3300042656 Ga0466732_295544 Ga0466732_295544_3166_4002 278
53 iso_pr_bacteria 2781125697 2781442148 278
54 3300000089 AustNasuHG_c1001780 AustNasuHG_10017807 279
55 3300002504 JGI24705J35276_12206305 JGI24705J35276_122063052 279
56 3300042594 Ga0466694_360805 Ga0466694_360805_162_1001 279
57 3300042656 Ga0466732_280874 Ga0466732_280874_576_1415 279
58 3300042590 Ga0466690_031458 Ga0466690_031458_378_1220 280
59 3300042593 Ga0466691_117958 Ga0466691_117958_23213_24055 280
60 3300042596 Ga0466696_036611 Ga0466696_036611_517_1359 280
61 3300042596 Ga0466696_037451 Ga0466696_037451_209_1051 280
62 3300042596 Ga0466696_350222 Ga0466696_350222_17_859 280
63 3300042606 Ga0466719_249016 Ga0466719_249016_238_1080 280
64 3300042609 Ga0466722_023448 Ga0466722_023448_9104_9946 280
65 3300042610 Ga0466698_051612 Ga0466698_051612_352_1194 280
66 3300042612 Ga0466705_018346 Ga0466705_018346_7263_8105 280
67 3300042616 Ga0466715_083104 Ga0466715_083104_621_1463 280
68 3300042616 Ga0466715_156433 Ga0466715_156433_190_1032 280
69 3300042618 Ga0466723_015302 Ga0466723_015302_53_895 280
70 3300042618 Ga0466723_157044 Ga0466723_157044_7123_7965 280
71 3300042636 Ga0466703_005280 Ga0466703_005280_468_1310 280
72 3300042636 Ga0466703_250285 Ga0466703_250285_1701_2543 280
73 3300042643 Ga0466704_255505 Ga0466704_255505_806_1648 280
74 3300042643 Ga0466704_293873 Ga0466704_293873_1851_2693 280
75 3300042656 Ga0466732_112176 Ga0466732_112176_3790_4632 280
76 3300024493 Ga0264413_104713 Ga0264413_10471325 281
77 3300042550 Ga0466656_351002 Ga0466656_351002_1519_2364 281
78 3300042591 Ga0466692_172189 Ga0466692_172189_1492_2337 281
79 3300042596 Ga0466696_499919 Ga0466696_499919_1486_2331 281
80 3300042597 Ga0466699_271015 Ga0466699_271015_755_1600 281
81 3300042601 Ga0466707_175642 Ga0466707_175642_110_955 281
82 3300042601 Ga0466707_187733 Ga0466707_187733_298_1143 281
83 3300042601 Ga0466707_312745 Ga0466707_312745_549_1394 281
84 3300042605 Ga0466716_485331 Ga0466716_485331_210_1055 281
85 3300042616 Ga0466715_224063 Ga0466715_224063_3216_4061 281
86 3300042617 Ga0466718_013791 Ga0466718_013791_23300_24145 281
87 3300042618 Ga0466723_079137 Ga0466723_079137_1166_2011 281
88 3300042618 Ga0466723_082453 Ga0466723_082453_67525_68370 281
89 3300042619 Ga0466726_060061 Ga0466726_060061_991_1836 281
90 3300042619 Ga0466726_299720 Ga0466726_299720_966_1811 281
91 3300042619 Ga0466726_411589 Ga0466726_411589_226_1071 281
92 3300042619 Ga0466726_430238 Ga0466726_430238_169_1014 281
93 3300042624 Ga0466735_063117 Ga0466735_063117_461_1306 281
94 3300042624 Ga0466735_101535 Ga0466735_101535_69_914 281
95 3300042643 Ga0466704_398777 Ga0466704_398777_804_1649 281
96 3300042648 Ga0466709_020463 Ga0466709_020463_2398_3243 281
97 3300042652 Ga0466708_343355 Ga0466708_343355_2041_2886 281
98 3300042655 Ga0466727_187663 Ga0466727_187663_104_949 281
99 3300042656 Ga0466732_324392 Ga0466732_324392_1230_2075 281
100 3300042656 Ga0466732_380507 Ga0466732_380507_1631_2476 281
101 iso_pr_bacteria 2781125629 2781264256 281
102 iso_pr_bacteria 2781125655 2781317102 281
103 iso_pr_bacteria 650716102 650882408 281
104 3300000089 AustNasuHG_c1002650 AustNasuHG_10026506 282
105 3300000089 AustNasuHG_c1003909 AustNasuHG_10039097 282
106 3300000089 AustNasuHG_c1036359 AustNasuHG_10363591 282
107 3300002450 JGI24695J34938_10001273 JGI24695J34938_1000127322 282
108 3300002450 JGI24695J34938_10001457 JGI24695J34938_1000145715 282
109 3300002450 JGI24695J34938_10031656 JGI24695J34938_100316562 282
110 3300009826 Ga0123355_10000659 Ga0123355_1000065941 282
111 3300010049 Ga0123356_10000833 Ga0123356_1000083314 282
112 3300010049 Ga0123356_10045040 Ga0123356_100450403 282
113 3300024493 Ga0264413_103608 Ga0264413_1036087 282
114 3300024493 Ga0264413_107963 Ga0264413_1079632 282
115 3300024493 Ga0264413_125104 Ga0264413_1251049 282
116 3300024493 Ga0264413_133116 Ga0264413_1331168 282
117 3300042591 Ga0466692_082787 Ga0466692_082787_9931_10779 282
118 3300042591 Ga0466692_096393 Ga0466692_096393_865_1713 282
119 3300042593 Ga0466691_105856 Ga0466691_105856_56_904 282
120 3300042597 Ga0466699_007427 Ga0466699_007427_21595_22443 282
121 3300042597 Ga0466699_018975 Ga0466699_018975_7086_7934 282
122 3300042597 Ga0466699_027774 Ga0466699_027774_10397_11245 282
123 3300042597 Ga0466699_042694 Ga0466699_042694_7846_8694 282
124 3300042597 Ga0466699_059019 Ga0466699_059019_1375_2223 282
125 3300042597 Ga0466699_120425 Ga0466699_120425_24363_25211 282
126 3300042597 Ga0466699_186064 Ga0466699_186064_1701_2549 282
127 3300042597 Ga0466699_227539 Ga0466699_227539_82_930 282
128 3300042597 Ga0466699_247572 Ga0466699_247572_2733_3581 282
129 3300042606 Ga0466719_412865 Ga0466719_412865_26895_27743 282
130 3300042607 Ga0466720_046917 Ga0466720_046917_59029_59877 282
131 3300042607 Ga0466720_105750 Ga0466720_105750_994_1842 282
132 3300042607 Ga0466720_108024 Ga0466720_108024_20481_21329 282
133 3300042607 Ga0466720_131560 Ga0466720_131560_35165_36013 282
134 3300042607 Ga0466720_133222 Ga0466720_133222_1666_2514 282
135 3300042607 Ga0466720_139881 Ga0466720_139881_10088_10936 282
136 3300042607 Ga0466720_185900 Ga0466720_185900_5540_6388 282
137 3300042609 Ga0466722_119833 Ga0466722_119833_1907_2755 282
138 3300042612 Ga0466705_461230 Ga0466705_461230_3342_4190 282
139 3300042614 Ga0466712_036330 Ga0466712_036330_12357_13205 282
140 3300042614 Ga0466712_112275 Ga0466712_112275_16527_17375 282
141 3300042615 Ga0466711_231507 Ga0466711_231507_2122_2970 282
142 3300042616 Ga0466715_142776 Ga0466715_142776_2658_3506 282
143 3300042617 Ga0466718_160911 Ga0466718_160911_1558_2406 282
144 3300042643 Ga0466704_293302 Ga0466704_293302_10973_11821 282
145 3300042643 Ga0466704_543240 Ga0466704_543240_4099_4947 282
146 3300042656 Ga0466732_270943 Ga0466732_270943_1379_2227 282
147 iso_pr_bacteria 2772190978 2773730422 282
148 iso_pr_bacteria 2820016619 2820017419 282
149 3300000062 IMNBL1DRAFT_c0026171 IMNBL1DRAFT_00261712 283
150 3300000089 AustNasuHG_c1000422 AustNasuHG_10004223 283
151 3300000089 AustNasuHG_c1001151 AustNasuHG_10011512 283
152 3300000089 AustNasuHG_c1001293 AustNasuHG_10012937 283
153 3300002449 JGI24698J34947_10000837 JGI24698J34947_100008377 283
154 3300005200 Ga0072940_1022040 Ga0072940_10220403 283
155 3300005201 Ga0072941_1014903 Ga0072941_10149033 283
156 3300005201 Ga0072941_1048633 Ga0072941_10486336 283
157 3300005201 Ga0072941_1071072 Ga0072941_10710722 283
158 3300005201 Ga0072941_1085276 Ga0072941_10852761 283
159 3300010167 Ga0123353_10816845 Ga0123353_108168451 283
160 3300042597 Ga0466699_187061 Ga0466699_187061_1860_2711 283
161 3300042597 Ga0466699_195069 Ga0466699_195069_550_1401 283
162 3300042597 Ga0466699_200327 Ga0466699_200327_1532_2383 283
163 3300042597 Ga0466699_284466 Ga0466699_284466_1753_2604 283
164 3300042605 Ga0466716_259629 Ga0466716_259629_1821_2672 283
165 3300042615 Ga0466711_296871 Ga0466711_296871_150_1001 283
166 3300042615 Ga0466711_392692 Ga0466711_392692_3008_3859 283
167 3300002449 JGI24698J34947_10006069 JGI24698J34947_100060696 284
168 3300002450 JGI24695J34938_10000989 JGI24695J34938_1000098910 284
169 3300010167 Ga0123353_10424588 Ga0123353_104245882 284
170 3300042597 Ga0466699_320928 Ga0466699_320928_1720_2574 284
171 3300042602 Ga0466713_110798 Ga0466713_110798_87_941 284
172 3300042611 Ga0466697_102561 Ga0466697_102561_200_1054 284
173 3300042635 Ga0466702_326945 Ga0466702_326945_321_1175 284
174 iso_pr_bacteria 2740892546 2743910870 284
175 iso_pr_bacteria 2820014844 2820016554 284
176 3300005200 Ga0072940_1000948 Ga0072940_100094815 285
177 3300042615 Ga0466711_248653 Ga0466711_248653_2696_3553 285
178 3300042617 Ga0466718_117228 Ga0466718_117228_136_993 285
179 3300042622 Ga0466731_245932 Ga0466731_245932_26_883 285
180 3300042591 Ga0466692_013737 Ga0466692_013737_155_1015 286
181 3300042597 Ga0466699_088613 Ga0466699_088613_22097_22957 286
182 3300042597 Ga0466699_270029 Ga0466699_270029_432_1292 286
183 3300042609 Ga0466722_002841 Ga0466722_002841_1253_2113 286
184 iso_pr_bacteria 2819994798 2819995786 286
185 3300024493 Ga0264413_104259 Ga0264413_1042592 287
186 3300024493 Ga0264413_105993 Ga0264413_10599312 287
187 3300042593 Ga0466691_097761 Ga0466691_097761_6502_7365 287
188 3300042597 Ga0466699_219965 Ga0466699_219965_4383_5246 287
189 3300042606 Ga0466719_508191 Ga0466719_508191_1752_2615 287
190 3300042607 Ga0466720_208368 Ga0466720_208368_7911_8774 287
191 3300042616 Ga0466715_431253 Ga0466715_431253_1300_2163 287
192 3300042621 Ga0466729_050490 Ga0466729_050490_2666_3529 287
193 3300042643 Ga0466704_081910 Ga0466704_081910_129_992 287
194 3300042652 Ga0466708_063262 Ga0466708_063262_1735_2598 287
195 3300042591 Ga0466692_184475 Ga0466692_184475_1173_2039 288
196 3300042615 Ga0466711_426247 Ga0466711_426247_634_1500 288
197 3300042591 Ga0466692_002215 Ga0466692_002215_28036_28905 289
198 3300042619 Ga0466726_164213 Ga0466726_164213_2814_3695 293
199 3300005201 Ga0072941_1101477 Ga0072941_11014772 301
200 3300042643 Ga0466704_547934 Ga0466704_547934_1333_2244 303
201 3300005201 Ga0072941_1169186 Ga0072941_11691862 305
202 3300042643 Ga0466704_110351 Ga0466704_110351_113_1087 324
203 3300042643 Ga0466704_110295 Ga0466704_110295_1103_2113 336

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01061 ABC2_membrane ABC-2 type transporter 86 295 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.