Protein Family IF09361

Metagenome Isolate
125 Members
47 Samples
117 Scaffolds
311.2 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_101673|Ga0466704_101673_2800_3780
Length
326 aa
Sequence
MEKLSIIIPCYNEEASLPASYRRTRKALDGIAYDTEIIYVNDGSRDRTRPMLDAIAAADAQVKVIHFSRNFGHQPAVSAGIRHCDADWAIIMDADLQDPPELIPDILQHCRNEQANSVYCVRRSRENESWFKRFSARFFYRTLNRMVSEVKFPLDTGDFRLIDRKIMTEFKQLREHGKYIRGLVSWIGFRQVPFYYERKARMAGETKYPFRKMLGFASTALLYFSKKPLQMVVGLGFLAVLAGIFLAIWFTLGKIYGFSNAETGWTSLITTIIFFGGVQLLTVGVLGQYIGVLFDEIKNRPEYIIDEKRNFSDSEHKTNQENHQSS

📊 Sample Types

Isolate 6.4%
Metagenome 93.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 30.4%
Termitidae 28.3%
Blattidae 15.2%
Unclassified 6.5%
Termopsidae 6.5%
Passalidae 6.5%
Rhinotermitidae 4.3%
Apidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
18 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2923982719 Parabacteroides sp. 52 Isolate Blattidae
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
43 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
44 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_170581 3300042590 Bacteria 22522
2 Ga0466723_080108 3300042618 Bacteria 10882
3 Ga0466726_103938 3300042619 Bacteria 5696
4 Ga0466728_059478 3300042620 Bacteria 7657
5 Ga0466703_281122 3300042636 Bacteria 5177
6 Ga0466727_080215 3300042655 Bacteria 8461
7 Ga0466727_286392 3300042655 Bacteria 3300
8 Ga0466713_011183 3300042602 Bacteria 6139
9 Ga0466713_058263 3300042602 Bacteria 11192
10 Ga0466719_019865 3300042606 Bacteria 6113
11 Ga0466719_530151 3300042606 Bacteria 9750
12 Ga0466722_178775 3300042609 Bacteria 4341
13 IMNBL1DRAFT_c0004830 3300000062 Bacteria 7945
14 JGI24702J35022_10010204 3300002462 Bacteria 5259
15 JGI24705J35276_12238008 3300002504 Bacteria 14996
16 Ga0068305_10072282 3300005083 Bacteria 16989
17 Ga0466690_038742 3300042590 Bacteria 8913
18 Ga0466693_228016 3300042592 Bacteria 1308
19 Ga0466691_002903 3300042593 Bacteria 4497
20 Ga0466705_402663 3300042612 Bacteria 7474
21 Ga0466735_034634 3300042624 Bacteria 1628
22 Ga0466703_131700 3300042636 Bacteria 9668
23 Ga0466704_117322 3300042643 Bacteria 8093
24 Ga0466709_212421 3300042648 Bacteria 5539
25 Ga0466709_224534 3300042648 Bacteria 5314
26 Ga0466708_145890 3300042652 Bacteria 28616
27 Ga0466713_032102 3300042602 Bacteria 14406
28 Ga0466722_008658 3300042609 Bacteria 59548
29 Ga0466722_162933 3300042609 Bacteria 1520
30 Ga0466722_201581 3300042609 Bacteria 8348
31 Ga0068305_10041304 3300005083 Bacteria 6951
32 Ga0466697_192053 3300042611 Bacteria 4196
33 Ga0466705_359956 3300042612 Bacteria 10402
34 Ga0466733_025956 3300042659 Bacteria 21507
35 Ga0466690_160873 3300042590 Bacteria 11958
36 Ga0466696_059095 3300042596 Bacteria 32844
37 Ga0466715_208336 3300042616 Bacteria 27563
38 Ga0466715_380145 3300042616 Bacteria 11285
39 Ga0466723_039609 3300042618 Bacteria 24007
40 Ga0123353_10158634 3300010167 Bacteria 3603
41 Ga0466704_092165 3300042643 Bacteria 5261
42 Ga0466707_169356 3300042601 Bacteria 5977
43 Ga0466716_240023 3300042605 Unclassified 23065
44 2227072454 2225789003 Bacteria 12548
45 Ga0466733_018035 3300042659 Bacteria 2116
46 Ga0466690_372875 3300042590 Bacteria 7171
47 Ga0466693_003559 3300042592 Bacteria 1562
48 Ga0466696_020700 3300042596 Unclassified 2186
49 Ga0466723_194966 3300042618 Bacteria 3966
50 Ga0466728_119808 3300042620 Bacteria 2629
51 Ga0466703_116268 3300042636 Bacteria 4299
52 Ga0466703_294968 3300042636 Bacteria 10757
53 Ga0466704_068042 3300042643 Bacteria 11837
54 Ga0466704_298005 3300042643 Bacteria 30474
55 Ga0466709_345553 3300042648 Bacteria 18572
56 Ga0466727_315449 3300042655 Bacteria 7913
57 Ga0466716_485882 3300042605 Bacteria 12860
58 IMNBL1DRAFT_c0000998 3300000062 Bacteria 21823
59 Ga0466694_149791 3300042594 Bacteria 1663
60 Ga0466712_155693 3300042614 Bacteria 1259
61 Ga0466711_283634 3300042615 Bacteria 13443
62 Ga0466715_599583 3300042616 Bacteria 8873
63 Ga0123356_10051026 3300010049 Bacteria 3848
64 Ga0466735_193876 3300042624 Bacteria 2250
65 Ga0466725_225545 3300042654 Bacteria 19445
66 Ga0466713_131815 3300042602 Bacteria 24015
67 Ga0466716_158904 3300042605 Bacteria 11394
68 Ga0466719_035832 3300042606 Bacteria 2760
69 Ga0466722_029337 3300042609 Bacteria 8832
70 2227532133 2225789004 Bacteria 3130
71 JGI24702J35022_10001776 3300002462 Bacteria 13316
72 Ga0466705_075969 3300042612 Bacteria 2867
73 Ga0466705_302270 3300042612 Bacteria 5916
74 Ga0466690_305792 3300042590 Bacteria 2530
75 Ga0466711_032755 3300042615 Bacteria 36049
76 Ga0466711_050931 3300042615 Bacteria 16468
77 Ga0466726_146193 3300042619 Bacteria 1482
78 Ga0466704_481377 3300042643 Bacteria 3090
79 Ga0466727_313462 3300042655 Bacteria 28907
80 Ga0466707_116579 3300042601 Bacteria 3836
81 Ga0466713_061381 3300042602 Bacteria 4707
82 Ga0466716_260414 3300042605 Bacteria 24668
83 Ga0466705_120499 3300042612 Bacteria 7279
84 Ga0265387_1001125 3300024582 Bacteria 3938
85 Ga0466690_109436 3300042590 Bacteria 22456
86 Ga0466690_119673 3300042590 Bacteria 4726
87 Ga0466696_487403 3300042596 Bacteria 9457
88 Ga0466711_505448 3300042615 Bacteria 4158
89 Ga0466715_012002 3300042616 Bacteria 9704
90 Ga0466715_140413 3300042616 Bacteria 41137
91 Ga0466715_476343 3300042616 Bacteria 2087
92 Ga0466715_546218 3300042616 Bacteria 6555
93 Ga0466723_154978 3300042618 Bacteria 69722
94 Ga0466726_156109 3300042619 Bacteria 3426
95 Ga0466728_331002 3300042620 Bacteria 10249
96 Ga0466728_424041 3300042620 Bacteria 46685
97 Ga0466731_364768 3300042622 Bacteria 3364
98 Ga0466704_101673 3300042643 Bacteria 7423
99 Ga0466704_393273 3300042643 Bacteria 3407
100 Ga0466708_081063 3300042652 Bacteria 11143
101 Ga0466716_047411 3300042605 Bacteria 1167
102 Ga0466719_397179 3300042606 Bacteria 5840
103 Ga0466705_055883 3300042612 Bacteria 4044
104 Ga0466656_111656 3300042550 Bacteria 19404
105 Ga0466690_028589 3300042590 Bacteria 8462
106 Ga0466693_426076 3300042592 Bacteria 4395
107 Ga0466691_204483 3300042593 Bacteria 1276
108 Ga0466696_138321 3300042596 Bacteria 2356
109 Ga0466718_008042 3300042617 Bacteria 1680
110 Ga0466723_249509 3300042618 Bacteria 2197
111 Ga0466728_013139 3300042620 Bacteria 55903
112 Ga0466728_333875 3300042620 Bacteria 32046
113 Ga0466729_158795 3300042621 Bacteria 7464
114 Ga0466704_071184 3300042643 Bacteria 14034
115 Ga0466708_199657 3300042652 Bacteria 28689
116 Ga0466727_072344 3300042655 Bacteria 14946
117 IMNBL1DRAFT_c0001689 3300000062 Bacteria 16277

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_169356 Ga0466707_169356_3411_4196 261
2 3300042616 Ga0466715_476343 Ga0466715_476343_68_919 265
3 3300042624 Ga0466735_193876 Ga0466735_193876_1094_1927 277
4 3300042609 Ga0466722_162933 Ga0466722_162933_331_1176 281
5 3300042605 Ga0466716_047411 Ga0466716_047411_296_1150 284
6 3300042612 Ga0466705_302270 Ga0466705_302270_4328_5182 284
7 3300042643 Ga0466704_481377 Ga0466704_481377_1823_2755 284
8 3300042619 Ga0466726_103938 Ga0466726_103938_1053_1985 298
9 3300000062 IMNBL1DRAFT_c0000998 IMNBL1DRAFT_00009989 303
10 3300042590 Ga0466690_119673 Ga0466690_119673_1658_2587 309
11 3300042602 Ga0466713_058263 Ga0466713_058263_314_1243 309
12 2225789004 2227532133 2228045081 310
13 3300042590 Ga0466690_028589 Ga0466690_028589_3216_4148 310
14 3300042590 Ga0466690_170581 Ga0466690_170581_19889_20821 310
15 3300042590 Ga0466690_305792 Ga0466690_305792_852_1784 310
16 3300042592 Ga0466693_228016 Ga0466693_228016_101_1033 310
17 3300042593 Ga0466691_002903 Ga0466691_002903_3238_4170 310
18 3300042593 Ga0466691_204483 Ga0466691_204483_267_1199 310
19 3300042596 Ga0466696_020700 Ga0466696_020700_420_1352 310
20 3300042596 Ga0466696_059095 Ga0466696_059095_6980_7912 310
21 3300042596 Ga0466696_487403 Ga0466696_487403_668_1600 310
22 3300042601 Ga0466707_116579 Ga0466707_116579_224_1156 310
23 3300042602 Ga0466713_011183 Ga0466713_011183_3418_4350 310
24 3300042602 Ga0466713_032102 Ga0466713_032102_7264_8196 310
25 3300042605 Ga0466716_240023 Ga0466716_240023_11261_12193 310
26 3300042605 Ga0466716_260414 Ga0466716_260414_4465_5397 310
27 3300042606 Ga0466719_530151 Ga0466719_530151_2412_3344 310
28 3300042612 Ga0466705_055883 Ga0466705_055883_2209_3141 310
29 3300042612 Ga0466705_075969 Ga0466705_075969_1068_2000 310
30 3300042612 Ga0466705_120499 Ga0466705_120499_5931_6863 310
31 3300042615 Ga0466711_050931 Ga0466711_050931_4654_5586 310
32 3300042615 Ga0466711_505448 Ga0466711_505448_2403_3335 310
33 3300042616 Ga0466715_208336 Ga0466715_208336_22643_23575 310
34 3300042618 Ga0466723_039609 Ga0466723_039609_676_1608 310
35 3300042618 Ga0466723_080108 Ga0466723_080108_9294_10226 310
36 3300042618 Ga0466723_249509 Ga0466723_249509_524_1456 310
37 3300042619 Ga0466726_146193 Ga0466726_146193_412_1344 310
38 3300042619 Ga0466726_156109 Ga0466726_156109_2158_3090 310
39 3300042620 Ga0466728_059478 Ga0466728_059478_5682_6614 310
40 3300042636 Ga0466703_131700 Ga0466703_131700_7665_8597 310
41 3300042636 Ga0466703_294968 Ga0466703_294968_8215_9147 310
42 3300042643 Ga0466704_068042 Ga0466704_068042_10029_10961 310
43 3300042643 Ga0466704_092165 Ga0466704_092165_1545_2477 310
44 3300042643 Ga0466704_298005 Ga0466704_298005_23199_24131 310
45 3300042648 Ga0466709_224534 Ga0466709_224534_4347_5279 310
46 3300042648 Ga0466709_345553 Ga0466709_345553_3075_4007 310
47 3300042654 Ga0466725_225545 Ga0466725_225545_12074_13006 310
48 3300042655 Ga0466727_072344 Ga0466727_072344_10144_11076 310
49 3300042655 Ga0466727_313462 Ga0466727_313462_16589_17521 310
50 3300042655 Ga0466727_315449 Ga0466727_315449_5604_6536 310
51 3300000062 IMNBL1DRAFT_c0001689 IMNBL1DRAFT_00016894 311
52 3300005083 Ga0068305_10041304 Ga0068305_100413043 311
53 3300042550 Ga0466656_111656 Ga0466656_111656_4552_5487 311
54 3300042616 Ga0466715_012002 Ga0466715_012002_8432_9367 311
55 3300042617 Ga0466718_008042 Ga0466718_008042_708_1643 311
56 3300042624 Ga0466735_034634 Ga0466735_034634_593_1528 311
57 3300042636 Ga0466703_116268 Ga0466703_116268_137_1072 311
58 3300042643 Ga0466704_071184 Ga0466704_071184_11112_12047 311
59 3300042659 Ga0466733_018035 Ga0466733_018035_715_1650 311
60 3300042590 Ga0466690_038742 Ga0466690_038742_3341_4279 312
61 3300042590 Ga0466690_109436 Ga0466690_109436_20218_21156 312
62 3300042590 Ga0466690_160873 Ga0466690_160873_5959_6897 312
63 3300042592 Ga0466693_003559 Ga0466693_003559_376_1314 312
64 3300042592 Ga0466693_426076 Ga0466693_426076_3141_4079 312
65 3300042594 Ga0466694_149791 Ga0466694_149791_400_1338 312
66 3300042596 Ga0466696_138321 Ga0466696_138321_584_1522 312
67 3300042602 Ga0466713_131815 Ga0466713_131815_2564_3502 312
68 3300042605 Ga0466716_485882 Ga0466716_485882_2042_2980 312
69 3300042609 Ga0466722_178775 Ga0466722_178775_838_1776 312
70 3300042616 Ga0466715_380145 Ga0466715_380145_8273_9211 312
71 3300042618 Ga0466723_154978 Ga0466723_154978_37862_38800 312
72 3300042620 Ga0466728_331002 Ga0466728_331002_9105_10043 312
73 3300042652 Ga0466708_145890 Ga0466708_145890_16734_17672 312
74 3300042652 Ga0466708_199657 Ga0466708_199657_25880_26818 312
75 3300042655 Ga0466727_080215 Ga0466727_080215_5128_6066 312
76 iso_pr_bacteria 2940199050 2940201372 312
77 iso_pr_bacteria 2940209341 2940209991 312
78 iso_pr_bacteria 2940346213 2940349212 312
79 3300002462 JGI24702J35022_10001776 JGI24702J35022_100017764 313
80 3300002462 JGI24702J35022_10010204 JGI24702J35022_100102043 313
81 3300002504 JGI24705J35276_12238008 JGI24705J35276_122380088 313
82 3300005083 Ga0068305_10072282 Ga0068305_1007228217 313
83 3300010167 Ga0123353_10158634 Ga0123353_101586343 313
84 3300042614 Ga0466712_155693 Ga0466712_155693_141_1082 313
85 3300042616 Ga0466715_599583 Ga0466715_599583_5314_6255 313
86 3300042620 Ga0466728_119808 Ga0466728_119808_796_1737 313
87 3300042655 Ga0466727_286392 Ga0466727_286392_214_1155 313
88 iso_pr_bacteria 2923982719 2923983447 313
89 iso_pr_bacteria 2940195863 2940196025 313
90 iso_pr_bacteria 2940202316 2940204213 313
91 iso_pr_bacteria 2940371297 2940371377 313
92 3300042602 Ga0466713_061381 Ga0466713_061381_2391_3335 314
93 3300042606 Ga0466719_019865 Ga0466719_019865_454_1398 314
94 3300042612 Ga0466705_402663 Ga0466705_402663_5509_6453 314
95 3300042643 Ga0466704_393273 Ga0466704_393273_218_1162 314
96 3300024582 Ga0265387_1001125 Ga0265387_10011253 315
97 3300042606 Ga0466719_035832 Ga0466719_035832_1106_2086 315
98 3300042616 Ga0466715_140413 Ga0466715_140413_18691_19638 315
99 3300010049 Ga0123356_10051026 Ga0123356_100510264 316
100 3300042605 Ga0466716_158904 Ga0466716_158904_2939_3889 316
101 3300042609 Ga0466722_008658 Ga0466722_008658_42754_43704 316
102 3300042609 Ga0466722_029337 Ga0466722_029337_2954_3904 316
103 3300042590 Ga0466690_372875 Ga0466690_372875_6106_7059 317
104 3300042612 Ga0466705_359956 Ga0466705_359956_429_1400 317
105 3300042620 Ga0466728_013139 Ga0466728_013139_48311_49264 317
106 3300042620 Ga0466728_333875 Ga0466728_333875_19091_20044 317
107 3300042620 Ga0466728_424041 Ga0466728_424041_13368_14321 317
108 3300042611 Ga0466697_192053 Ga0466697_192053_1466_2422 318
109 3300042615 Ga0466711_032755 Ga0466711_032755_28487_29443 318
110 3300042636 Ga0466703_281122 Ga0466703_281122_3495_4466 318
111 3300042643 Ga0466704_117322 Ga0466704_117322_5184_6140 318
112 3300042659 Ga0466733_025956 Ga0466733_025956_17149_18105 318
113 2225789003 2227072454 2227435347 321
114 3300042609 Ga0466722_201581 Ga0466722_201581_3391_4356 321
115 3300042618 Ga0466723_194966 Ga0466723_194966_932_1900 322
116 3300042621 Ga0466729_158795 Ga0466729_158795_186_1154 322
117 3300000062 IMNBL1DRAFT_c0004830 IMNBL1DRAFT_00048306 323
118 3300042606 Ga0466719_397179 Ga0466719_397179_3547_4518 323
119 3300042622 Ga0466731_364768 Ga0466731_364768_131_1102 323
120 3300042652 Ga0466708_081063 Ga0466708_081063_356_1327 323
121 3300042615 Ga0466711_283634 Ga0466711_283634_4655_5662 325
122 3300042643 Ga0466704_101673 Ga0466704_101673_2800_3780 326
123 3300042648 Ga0466709_212421 Ga0466709_212421_2048_3028 326
124 3300042616 Ga0466715_546218 Ga0466715_546218_1800_2792 330
125 iso_pr_bacteria 8065497608 8065497988 334

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 5 167 0.96
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 4 175 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.