Protein Family IF09336

Metagenome Isolate
221 Members
49 Samples
212 Scaffolds
534.36 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_070672|Ga0466704_070672_4789_6666
Length
580 aa
Sequence
VYRGAGKNTGETFGIPCRSVSKIRGIEDSGGRLYKFFSGIFPAPMEYAVLWVKFNLLYMLHTAKIIAQKLNSILDRKRKFYLIVLFFLSVLLSAVETAGVSVVMPFISAASNPAVIDSGWYKYFFDLLGFSSKNTFVISFGIAIIVFYIFRSFFNIFYNYSINKFSLGTFRHFATRLFKTYLALPYKVYVQKNPSVFSQMISNEANSLSELLLRRLSKKLGEKRYAANVKLSRTLWETFGNFKFIKLKGNEDKILQVFTDSVGRLSHASVISSTLGTIPKNVLENLGFSLLIAAVCFILWRYDSAEMVIPVISMYALALYRALPAVNHILEHFNEIAYREQSLHMIYDDMNLETDDEGSSPVSFTTSIRGEDLAFRYLKGDEVIKNISLEIRIGEKIAFVGESGSGKTTLVDILIGIYRPLQGHIYVDNVLIDHTNIRSWRTKIGYIPQSIYLFDGTVAENVAFGSDYHEEKIIQVLNKAKIWDFLNSKEGINTLVGEGGIQLSGGQKQRIGIARALYNDPEVLVLDEATSSLDDETESQIMNEIYDVSGSKTLIIIAHRLSTVERCDRRIQIENGMVAG

πŸ“Š Sample Types

Isolate 4.1%
Metagenome 95.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 40.4%
Kalotermitidae 29.8%
Unclassified 19.1%
Termopsidae 4.3%
Rhinotermitidae 4.3%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 213
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
2 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
26 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_026187 3300042612 Bacteria 2611
2 Ga0466732_447845 3300042656 Bacteria 4960
3 Ga0466712_118468 3300042614 Bacteria 28270
4 Ga0466712_280202 3300042614 Bacteria 19137
5 Ga0466718_012825 3300042617 Bacteria 18566
6 Ga0466718_159812 3300042617 Bacteria 6228
7 Ga0466723_023955 3300042618 Bacteria 16255
8 Ga0466723_037046 3300042618 Bacteria 13391
9 Ga0466690_110363 3300042590 Bacteria 13720
10 Ga0466690_245723 3300042590 Bacteria 3249
11 Ga0466695_397366 3300042595 Bacteria 13529
12 Ga0466699_265912 3300042597 Bacteria 12263
13 Ga0123356_10000141 3300010049 Bacteria 81679
14 AustNasuHG_c1001711 3300000089 Bacteria 7924
15 JGI24698J34947_10000750 3300002449 Bacteria 15987
16 JGI24702J35022_10001440 3300002462 Bacteria 14831
17 Ga0072941_1037413 3300005201 Bacteria 14966
18 Ga0123357_10002404 3300009784 Bacteria 20853
19 Ga0466720_234294 3300042607 Bacteria 6316
20 Ga0466722_194492 3300042609 Bacteria 16499
21 Ga0466704_070672 3300042643 Bacteria 9468
22 Ga0466704_140178 3300042643 Bacteria 60046
23 Ga0466704_318801 3300042643 Bacteria 4518
24 Ga0466704_327262 3300042643 Bacteria 9813
25 Ga0466709_335917 3300042648 Bacteria 15035
26 Ga0466708_007812 3300042652 Bacteria 5701
27 Ga0466705_022584 3300042612 Bacteria 11422
28 Ga0466712_006591 3300042614 Bacteria 27960
29 Ga0466712_024790 3300042614 Bacteria 10813
30 Ga0466712_131789 3300042614 Bacteria 31060
31 Ga0466712_158108 3300042614 Bacteria 28019
32 Ga0466715_349454 3300042616 Bacteria 41739
33 Ga0466718_164899 3300042617 Bacteria 6068
34 Ga0466723_103048 3300042618 Bacteria 13029
35 Ga0466726_270297 3300042619 Bacteria 3185
36 Ga0466728_003420 3300042620 Bacteria 3244
37 Ga0466691_170012 3300042593 Bacteria 38393
38 Ga0466694_123440 3300042594 Bacteria 50310
39 Ga0466694_260291 3300042594 Bacteria 2533
40 Ga0466694_273428 3300042594 Bacteria 6256
41 Ga0466699_004244 3300042597 Bacteria 7305
42 Ga0466699_033452 3300042597 Bacteria 4849
43 JGI24695J34938_10007145 3300002450 Bacteria 6592
44 JGI24695J34938_10021187 3300002450 Bacteria 3185
45 JGI24695J34938_10047928 3300002450 Unclassified 1884
46 Ga0466706_095306 3300042599 Bacteria 2256
47 Ga0466719_043858 3300042606 Bacteria 23279
48 Ga0466720_010554 3300042607 Bacteria 31855
49 Ga0466720_221349 3300042607 Bacteria 1822
50 Ga0466704_130875 3300042643 Bacteria 19898
51 Ga0466709_175443 3300042648 Bacteria 7310
52 Ga0466705_152278 3300042612 Bacteria 9940
53 Ga0466705_266113 3300042612 Bacteria 67009
54 Ga0466711_287554 3300042615 Bacteria 2543
55 Ga0466711_391747 3300042615 Bacteria 3022
56 Ga0466711_495626 3300042615 Bacteria 6307
57 Ga0466715_372618 3300042616 Bacteria 15643
58 Ga0466718_132190 3300042617 Bacteria 17802
59 Ga0466718_139708 3300042617 Bacteria 35662
60 Ga0466690_158566 3300042590 Bacteria 14279
61 Ga0466692_163898 3300042591 Bacteria 25340
62 Ga0466693_354959 3300042592 Bacteria 16157
63 Ga0466691_002443 3300042593 Bacteria 21767
64 Ga0466691_097118 3300042593 Bacteria 6676
65 Ga0466691_163744 3300042593 Bacteria 6544
66 Ga0466696_264178 3300042596 Bacteria 5757
67 JGI24698J34947_10040387 3300002449 Bacteria 2409
68 JGI24695J34938_10021162 3300002450 Bacteria 3186
69 JGI24705J35276_12227620 3300002504 Bacteria 3034
70 Ga0466707_185678 3300042601 Bacteria 4366
71 Ga0466720_041453 3300042607 Bacteria 36391
72 Ga0466720_082143 3300042607 Bacteria 16394
73 Ga0466720_144493 3300042607 Bacteria 11063
74 Ga0466720_218163 3300042607 Bacteria 21590
75 Ga0466722_081727 3300042609 Bacteria 33452
76 Ga0466698_106901 3300042610 Unclassified 1621
77 Ga0466703_113663 3300042636 Bacteria 6581
78 Ga0466704_456469 3300042643 Bacteria 11582
79 Ga0466708_036566 3300042652 Bacteria 4251
80 Ga0466708_210315 3300042652 Bacteria 30080
81 Ga0466708_226294 3300042652 Bacteria 2654
82 Ga0466705_077409 3300042612 Bacteria 44024
83 Ga0466705_138412 3300042612 Bacteria 3910
84 Ga0466723_240661 3300042618 Bacteria 25040
85 Ga0466726_486218 3300042619 Bacteria 2144
86 Ga0466728_290929 3300042620 Bacteria 48933
87 Ga0264413_124108 3300024493 Bacteria 5718
88 Ga0466694_088136 3300042594 Bacteria 4152
89 Ga0466694_339539 3300042594 Bacteria 3652
90 Ga0466699_042667 3300042597 Bacteria 3648
91 Ga0466699_157175 3300042597 Bacteria 55178
92 Ga0123355_10260200 3300009826 Bacteria 2427
93 JGI24698J34947_10002414 3300002449 Bacteria 10060
94 JGI24698J34947_10010360 3300002449 Bacteria 5111
95 JGI24698J34947_10022201 3300002449 Bacteria 3407
96 JGI24695J34938_10023828 3300002450 Bacteria 2946
97 Ga0072941_1001626 3300005201 Bacteria 73081
98 Ga0466716_041026 3300042605 Bacteria 3955
99 Ga0466720_167253 3300042607 Unclassified 11837
100 Ga0466722_008365 3300042609 Bacteria 9140
101 Ga0466722_232568 3300042609 Bacteria 3180
102 Ga0466703_046739 3300042636 Bacteria 28227
103 Ga0466704_083234 3300042643 Bacteria 13562
104 Ga0466704_136762 3300042643 Bacteria 15015
105 Ga0466709_036259 3300042648 Bacteria 16966
106 Ga0466709_083592 3300042648 Bacteria 16599
107 Ga0466709_315748 3300042648 Bacteria 19630
108 Ga0466705_226559 3300042612 Bacteria 16010
109 Ga0466712_088146 3300042614 Bacteria 27823
110 Ga0466712_136649 3300042614 Bacteria 51583
111 Ga0466711_253861 3300042615 Bacteria 27822
112 Ga0466711_340632 3300042615 Unclassified 1594
113 Ga0466715_500757 3300042616 Bacteria 14213
114 Ga0466718_063600 3300042617 Bacteria 2529
115 Ga0466723_020410 3300042618 Bacteria 8029
116 Ga0466726_168129 3300042619 Unclassified 10475
117 Ga0466728_192264 3300042620 Bacteria 1882
118 Ga0264413_108172 3300024493 Bacteria 18399
119 Ga0466692_022510 3300042591 Bacteria 16288
120 Ga0466696_024558 3300042596 Bacteria 2566
121 Ga0466699_207465 3300042597 Bacteria 20344
122 JGI24698J34947_10013530 3300002449 Bacteria 4453
123 JGI24695J34938_10000004 3300002450 Bacteria 163071
124 JGI24695J34938_10000355 3300002450 Bacteria 45167
125 JGI24695J34938_10001747 3300002450 Bacteria 17965
126 Ga0072941_1015849 3300005201 Bacteria 9098
127 Ga0466716_079617 3300042605 Bacteria 17316
128 Ga0466716_178381 3300042605 Bacteria 7917
129 Ga0466719_219629 3300042606 Bacteria 1960
130 Ga0466719_370505 3300042606 Bacteria 17953
131 Ga0466720_041333 3300042607 Bacteria 12993
132 Ga0466703_243490 3300042636 Bacteria 3608
133 Ga0466708_228224 3300042652 Bacteria 1956
134 Ga0466708_361652 3300042652 Bacteria 14642
135 Ga0466727_137706 3300042655 Bacteria 6745
136 Ga0466705_193582 3300042612 Bacteria 8264
137 Ga0466705_356815 3300042612 Bacteria 5435
138 Ga0466711_120623 3300042615 Bacteria 13216
139 Ga0466718_102882 3300042617 Bacteria 7976
140 Ga0466723_017008 3300042618 Bacteria 19278
141 Ga0466728_128545 3300042620 Bacteria 7781
142 Ga0264413_102054 3300024493 Bacteria 17579
143 Ga0264413_105157 3300024493 Bacteria 12734
144 Ga0466690_027457 3300042590 Bacteria 3720
145 Ga0466690_029730 3300042590 Bacteria 11611
146 Ga0466692_190486 3300042591 Bacteria 17825
147 Ga0466691_011813 3300042593 Bacteria 14800
148 Ga0466694_086692 3300042594 Bacteria 12622
149 Ga0466694_403400 3300042594 Bacteria 17229
150 Ga0466699_082086 3300042597 Bacteria 10645
151 Ga0466699_261341 3300042597 Bacteria 3427
152 Ga0123356_10000062 3300010049 Bacteria 112695
153 Ga0123356_10000577 3300010049 Bacteria 40782
154 Ga0123356_10095698 3300010049 Bacteria 2839
155 Ga0123354_10124603 3300010882 Bacteria 3301
156 JGI24698J34947_10000368 3300002449 Bacteria 20225
157 JGI24698J34947_10003320 3300002449 Bacteria 8728
158 Ga0466722_220602 3300042609 Bacteria 8344
159 Ga0466703_067337 3300042636 Bacteria 6874
160 Ga0466704_055823 3300042643 Bacteria 9511
161 Ga0466704_272070 3300042643 Bacteria 6146
162 Ga0466712_113634 3300042614 Bacteria 19500
163 Ga0466712_132504 3300042614 Bacteria 15531
164 Ga0466711_155526 3300042615 Bacteria 10888
165 Ga0466715_102597 3300042616 Bacteria 4425
166 Ga0466718_047088 3300042617 Bacteria 6864
167 Ga0466726_328179 3300042619 Bacteria 13195
168 Ga0466728_172836 3300042620 Bacteria 4381
169 Ga0264413_118595 3300024493 Bacteria 6862
170 Ga0466690_286844 3300042590 Bacteria 49813
171 Ga0466691_158280 3300042593 Bacteria 7766
172 AustNasuHG_c1007818 3300000089 Bacteria 3793
173 JGI24698J34947_10030422 3300002449 Unclassified 2847
174 JGI24695J34938_10019402 3300002450 Bacteria 3370
175 JGI24702J35022_10000136 3300002462 Bacteria 36676
176 Ga0072940_1020901 3300005200 Bacteria 18403
177 Ga0123357_10000143 3300009784 Bacteria 62834
178 Ga0466713_132618 3300042602 Bacteria 2217
179 Ga0466716_424797 3300042605 Bacteria 4880
180 Ga0466716_500725 3300042605 Bacteria 24017
181 Ga0466720_029809 3300042607 Bacteria 15349
182 Ga0466722_164986 3300042609 Bacteria 11140
183 Ga0466703_060786 3300042636 Bacteria 15061
184 Ga0466703_320400 3300042636 Bacteria 47272
185 Ga0466704_048303 3300042643 Bacteria 15236
186 Ga0466709_394183 3300042648 Bacteria 2963
187 Ga0466708_458170 3300042652 Bacteria 2489
188 Ga0466727_165162 3300042655 Bacteria 6323
189 Ga0466712_038540 3300042614 Bacteria 38834
190 Ga0466712_281001 3300042614 Bacteria 2047
191 Ga0466718_033431 3300042617 Bacteria 4079
192 Ga0264413_120324 3300024493 Bacteria 6502
193 Ga0466694_011040 3300042594 Bacteria 12364
194 Ga0466694_206784 3300042594 Bacteria 3936
195 Ga0466696_196970 3300042596 Bacteria 17534
196 Ga0466696_429070 3300042596 Unclassified 3145
197 Ga0466699_191804 3300042597 Bacteria 7318
198 Ga0466699_277512 3300042597 Bacteria 6981
199 Ga0123356_10260217 3300010049 Bacteria 1818
200 JGI24695J34938_10000619 3300002450 Bacteria 33872
201 JGI24695J34938_10003081 3300002450 Bacteria 11925
202 JGI24695J34938_10003779 3300002450 Bacteria 10313
203 JGI24695J34938_10011890 3300002450 Bacteria 4653
204 Ga0072941_1012086 3300005201 Bacteria 7327
205 Ga0072941_1019938 3300005201 Bacteria 7224
206 Ga0466720_029258 3300042607 Bacteria 50082
207 Ga0466704_095694 3300042643 Bacteria 3164
208 Ga0466704_244046 3300042643 Bacteria 7252
209 Ga0466704_247197 3300042643 Bacteria 134498
210 Ga0466704_317387 3300042643 Unclassified 2447
211 Ga0466708_073931 3300042652 Bacteria 3014
212 Ga0466708_078052 3300042652 Bacteria 6931

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_340632 Ga0466711_340632_26_1468 452
2 3300042610 Ga0466698_106901 Ga0466698_106901_25_1605 464
3 3300042615 Ga0466711_155526 Ga0466711_155526_2651_4216 465
4 3300042619 Ga0466726_270297 Ga0466726_270297_625_2196 474
5 iso_pr_bacteria 2781125640 2781288696 480
6 3300042615 Ga0466711_287554 Ga0466711_287554_768_2384 481
7 3300042617 Ga0466718_033431 Ga0466718_033431_2367_3935 491
8 3300042617 Ga0466718_164899 Ga0466718_164899_3231_4940 492
9 3300042619 Ga0466726_486218 Ga0466726_486218_15_1649 494
10 3300042612 Ga0466705_152278 Ga0466705_152278_6059_7762 495
11 3300002450 JGI24695J34938_10000004 JGI24695J34938_10000004102 498
12 3300042614 Ga0466712_006591 Ga0466712_006591_14666_16285 498
13 3300042605 Ga0466716_178381 Ga0466716_178381_2443_4014 499
14 3300042614 Ga0466712_280202 Ga0466712_280202_13273_14886 499
15 3300042605 Ga0466716_079617 Ga0466716_079617_9931_11613 500
16 3300042607 Ga0466720_221349 Ga0466720_221349_52_1620 501
17 3300042594 Ga0466694_260291 Ga0466694_260291_855_2477 504
18 3300042614 Ga0466712_118468 Ga0466712_118468_3196_4815 504
19 3300042652 Ga0466708_078052 Ga0466708_078052_3620_5359 504
20 3300042643 Ga0466704_456469 Ga0466704_456469_9646_11349 505
21 3300042652 Ga0466708_073931 Ga0466708_073931_223_1926 505
22 3300024493 Ga0264413_120324 Ga0264413_1203244 507
23 3300042597 Ga0466699_033452 Ga0466699_033452_1165_2871 508
24 3300042597 Ga0466699_207465 Ga0466699_207465_16475_18178 508
25 3300042612 Ga0466705_226559 Ga0466705_226559_8135_9745 508
26 3300009784 Ga0123357_10000143 Ga0123357_1000014327 509
27 3300042605 Ga0466716_500725 Ga0466716_500725_6384_8072 509
28 3300042617 Ga0466718_139708 Ga0466718_139708_5771_7486 509
29 3300002462 JGI24702J35022_10001440 JGI24702J35022_100014403 510
30 3300042652 Ga0466708_228224 Ga0466708_228224_241_1944 510
31 3300024493 Ga0264413_102054 Ga0264413_1020545 511
32 3300024493 Ga0264413_105157 Ga0264413_1051573 511
33 3300042643 Ga0466704_048303 Ga0466704_048303_8925_10628 511
34 3300042643 Ga0466704_140178 Ga0466704_140178_47426_49141 511
35 3300002450 JGI24695J34938_10047928 JGI24695J34938_100479281 512
36 3300042595 Ga0466695_397366 Ga0466695_397366_5154_6767 512
37 3300042606 Ga0466719_370505 Ga0466719_370505_127_1830 512
38 3300042615 Ga0466711_253861 Ga0466711_253861_24128_25732 512
39 3300042609 Ga0466722_008365 Ga0466722_008365_2962_4587 513
40 3300042612 Ga0466705_266113 Ga0466705_266113_11071_12786 513
41 3300042652 Ga0466708_361652 Ga0466708_361652_9685_11388 513
42 3300042655 Ga0466727_165162 Ga0466727_165162_2922_4532 514
43 3300000089 AustNasuHG_c1007818 AustNasuHG_10078182 515
44 3300042620 Ga0466728_128545 Ga0466728_128545_6138_7763 515
45 3300005201 Ga0072941_1001626 Ga0072941_100162630 516
46 3300042596 Ga0466696_024558 Ga0466696_024558_163_1866 516
47 3300042614 Ga0466712_088146 Ga0466712_088146_13716_15341 516
48 3300042618 Ga0466723_023955 Ga0466723_023955_9279_10901 516
49 3300042643 Ga0466704_083234 Ga0466704_083234_8889_10592 516
50 3300042643 Ga0466704_247197 Ga0466704_247197_67961_69652 516
51 3300002450 JGI24695J34938_10007145 JGI24695J34938_100071452 517
52 3300042609 Ga0466722_220602 Ga0466722_220602_3250_4962 517
53 3300042614 Ga0466712_281001 Ga0466712_281001_88_1806 517
54 3300042643 Ga0466704_318801 Ga0466704_318801_2224_3927 517
55 3300002449 JGI24698J34947_10002414 JGI24698J34947_100024146 518
56 3300002450 JGI24695J34938_10000355 JGI24695J34938_1000035512 518
57 3300042597 Ga0466699_004244 Ga0466699_004244_2167_3780 518
58 3300042614 Ga0466712_038540 Ga0466712_038540_26511_28229 518
59 3300042616 Ga0466715_500757 Ga0466715_500757_12096_13799 518
60 3300042636 Ga0466703_067337 Ga0466703_067337_5027_6721 518
61 3300042593 Ga0466691_097118 Ga0466691_097118_3267_4886 519
62 3300042601 Ga0466707_185678 Ga0466707_185678_2060_3673 520
63 3300005201 Ga0072941_1019938 Ga0072941_10199382 521
64 3300042597 Ga0466699_191804 Ga0466699_191804_4130_5743 521
65 3300042618 Ga0466723_037046 Ga0466723_037046_10736_12439 521
66 3300042619 Ga0466726_168129 Ga0466726_168129_5997_7706 521
67 3300042643 Ga0466704_136762 Ga0466704_136762_2457_4079 521
68 3300002449 JGI24698J34947_10003320 JGI24698J34947_100033202 522
69 3300010049 Ga0123356_10000577 Ga0123356_1000057735 522
70 3300042597 Ga0466699_042667 Ga0466699_042667_508_2127 522
71 3300042590 Ga0466690_158566 Ga0466690_158566_2725_4341 523
72 3300002450 JGI24695J34938_10000619 JGI24695J34938_100006196 524
73 3300002462 JGI24702J35022_10000136 JGI24702J35022_1000013611 524
74 3300042593 Ga0466691_163744 Ga0466691_163744_2799_4538 524
75 3300042612 Ga0466705_077409 Ga0466705_077409_9693_11375 524
76 3300024493 Ga0264413_118595 Ga0264413_1185953 525
77 3300042597 Ga0466699_157175 Ga0466699_157175_46315_48033 525
78 3300042609 Ga0466722_194492 Ga0466722_194492_8085_9731 525
79 3300002449 JGI24698J34947_10030422 JGI24698J34947_100304222 526
80 3300002450 JGI24695J34938_10003779 JGI24695J34938_100037798 527
81 3300042594 Ga0466694_206784 Ga0466694_206784_1796_3499 527
82 3300042643 Ga0466704_130875 Ga0466704_130875_16478_18196 527
83 3300002449 JGI24698J34947_10000750 JGI24698J34947_100007505 528
84 3300010049 Ga0123356_10000062 Ga0123356_1000006236 528
85 3300042590 Ga0466690_027457 Ga0466690_027457_812_2443 528
86 3300042636 Ga0466703_060786 Ga0466703_060786_11683_13386 528
87 3300042648 Ga0466709_036259 Ga0466709_036259_6567_8198 528
88 3300005200 Ga0072940_1020901 Ga0072940_10209018 529
89 3300042594 Ga0466694_011040 Ga0466694_011040_10407_12047 529
90 3300042607 Ga0466720_029258 Ga0466720_029258_33003_34721 529
91 3300002450 JGI24695J34938_10023828 JGI24695J34938_100238281 530
92 3300042592 Ga0466693_354959 Ga0466693_354959_507_2213 530
93 3300042609 Ga0466722_232568 Ga0466722_232568_1205_2908 530
94 3300042617 Ga0466718_159812 Ga0466718_159812_2622_4340 530
95 3300042620 Ga0466728_172836 Ga0466728_172836_126_1829 530
96 3300042643 Ga0466704_244046 Ga0466704_244046_924_2627 530
97 3300042652 Ga0466708_007812 Ga0466708_007812_2634_4337 530
98 3300042617 Ga0466718_012825 Ga0466718_012825_3175_4878 531
99 3300042620 Ga0466728_290929 Ga0466728_290929_34769_36403 531
100 3300042590 Ga0466690_286844 Ga0466690_286844_18263_19891 532
101 3300002450 JGI24695J34938_10021162 JGI24695J34938_100211622 533
102 3300010049 Ga0123356_10095698 Ga0123356_100956982 533
103 3300024493 Ga0264413_108172 Ga0264413_1081723 534
104 3300042593 Ga0466691_002443 Ga0466691_002443_12117_13820 534
105 3300042607 Ga0466720_010554 Ga0466720_010554_6132_7850 534
106 3300002450 JGI24695J34938_10003081 JGI24695J34938_100030817 535
107 3300042605 Ga0466716_041026 Ga0466716_041026_308_2011 535
108 3300042607 Ga0466720_218163 Ga0466720_218163_11915_13633 535
109 3300042617 Ga0466718_063600 Ga0466718_063600_383_2107 535
110 3300010049 Ga0123356_10000141 Ga0123356_100001416 536
111 3300042607 Ga0466720_234294 Ga0466720_234294_1725_3428 536
112 3300042616 Ga0466715_349454 Ga0466715_349454_26691_28394 536
113 3300042599 Ga0466706_095306 Ga0466706_095306_522_2189 537
114 3300002449 JGI24698J34947_10010360 JGI24698J34947_100103604 538
115 3300042612 Ga0466705_138412 Ga0466705_138412_129_1832 538
116 3300042615 Ga0466711_391747 Ga0466711_391747_73_1776 538
117 3300042652 Ga0466708_226294 Ga0466708_226294_734_2443 538
118 3300042597 Ga0466699_082086 Ga0466699_082086_3078_4784 539
119 3300042597 Ga0466699_261341 Ga0466699_261341_1183_2883 539
120 3300042618 Ga0466723_103048 Ga0466723_103048_4885_6561 539
121 3300042636 Ga0466703_243490 Ga0466703_243490_154_1857 539
122 3300042648 Ga0466709_175443 Ga0466709_175443_2349_4052 539
123 3300042652 Ga0466708_458170 Ga0466708_458170_691_2394 539
124 3300005201 Ga0072941_1015849 Ga0072941_10158493 540
125 3300042606 Ga0466719_219629 Ga0466719_219629_240_1862 540
126 3300042655 Ga0466727_137706 Ga0466727_137706_862_2586 540
127 3300042656 Ga0466732_447845 Ga0466732_447845_1464_3182 540
128 3300042607 Ga0466720_144493 Ga0466720_144493_6128_7846 541
129 3300042643 Ga0466704_317387 Ga0466704_317387_453_2156 541
130 3300042648 Ga0466709_394183 Ga0466709_394183_986_2689 541
131 3300042618 Ga0466723_017008 Ga0466723_017008_8398_10113 542
132 3300002449 JGI24698J34947_10022201 JGI24698J34947_100222011 543
133 3300002450 JGI24695J34938_10001747 JGI24695J34938_1000174712 543
134 3300024493 Ga0264413_124108 Ga0264413_1241085 543
135 3300042606 Ga0466719_043858 Ga0466719_043858_1172_2875 543
136 3300042616 Ga0466715_372618 Ga0466715_372618_3303_4985 543
137 3300042620 Ga0466728_003420 Ga0466728_003420_917_2626 543
138 3300042607 Ga0466720_041333 Ga0466720_041333_509_2227 544
139 3300042617 Ga0466718_102882 Ga0466718_102882_5852_7561 544
140 3300002450 JGI24695J34938_10019402 JGI24695J34938_100194023 545
141 3300005201 Ga0072941_1012086 Ga0072941_10120863 545
142 3300042593 Ga0466691_011813 Ga0466691_011813_10715_12418 545
143 3300042594 Ga0466694_403400 Ga0466694_403400_13700_15400 545
144 3300042614 Ga0466712_131789 Ga0466712_131789_23680_25398 545
145 3300042617 Ga0466718_132190 Ga0466718_132190_8787_10505 545
146 3300042652 Ga0466708_036566 Ga0466708_036566_1005_2714 545
147 3300042591 Ga0466692_163898 Ga0466692_163898_21620_23329 546
148 3300042620 Ga0466728_192264 Ga0466728_192264_55_1758 546
149 3300042652 Ga0466708_210315 Ga0466708_210315_22097_23806 546
150 3300042596 Ga0466696_196970 Ga0466696_196970_9255_10964 547
151 3300042612 Ga0466705_026187 Ga0466705_026187_355_2055 547
152 3300042618 Ga0466723_020410 Ga0466723_020410_2139_3857 547
153 3300000089 AustNasuHG_c1001711 AustNasuHG_10017113 549
154 3300010049 Ga0123356_10260217 Ga0123356_102602171 549
155 3300010882 Ga0123354_10124603 Ga0123354_101246033 549
156 3300042607 Ga0466720_082143 Ga0466720_082143_1507_3210 549
157 3300042612 Ga0466705_356815 Ga0466705_356815_979_2718 549
158 3300042614 Ga0466712_136649 Ga0466712_136649_43610_45313 549
159 3300042617 Ga0466718_047088 Ga0466718_047088_2990_4708 549
160 3300042618 Ga0466723_240661 Ga0466723_240661_22086_23789 549
161 3300002450 JGI24695J34938_10011890 JGI24695J34938_100118903 550
162 3300042594 Ga0466694_088136 Ga0466694_088136_2081_3802 550
163 3300042596 Ga0466696_429070 Ga0466696_429070_702_2405 550
164 3300042612 Ga0466705_022584 Ga0466705_022584_2140_3831 550
165 3300042614 Ga0466712_113634 Ga0466712_113634_6405_8123 550
166 3300042643 Ga0466704_272070 Ga0466704_272070_1035_2738 550
167 3300042648 Ga0466709_335917 Ga0466709_335917_5083_6789 550
168 3300002449 JGI24698J34947_10013530 JGI24698J34947_100135303 551
169 3300042607 Ga0466720_029809 Ga0466720_029809_9300_11003 551
170 3300042607 Ga0466720_167253 Ga0466720_167253_9873_11576 551
171 3300042614 Ga0466712_158108 Ga0466712_158108_3627_5330 551
172 3300042615 Ga0466711_120623 Ga0466711_120623_1258_2964 551
173 3300042615 Ga0466711_495626 Ga0466711_495626_3926_5635 551
174 3300042616 Ga0466715_102597 Ga0466715_102597_2468_4171 551
175 3300042648 Ga0466709_083592 Ga0466709_083592_5703_7385 551
176 3300042648 Ga0466709_315748 Ga0466709_315748_16355_18055 551
177 3300002449 JGI24698J34947_10000368 JGI24698J34947_100003685 552
178 3300002504 JGI24705J35276_12227620 JGI24705J35276_122276202 552
179 3300042590 Ga0466690_029730 Ga0466690_029730_2126_3841 552
180 3300042602 Ga0466713_132618 Ga0466713_132618_34_1764 553
181 3300009784 Ga0123357_10002404 Ga0123357_100024043 554
182 3300009826 Ga0123355_10260200 Ga0123355_102602002 554
183 3300042643 Ga0466704_327262 Ga0466704_327262_4587_6290 554
184 3300042597 Ga0466699_277512 Ga0466699_277512_2881_4602 555
185 3300042591 Ga0466692_022510 Ga0466692_022510_2462_4189 557
186 3300042590 Ga0466690_110363 Ga0466690_110363_11439_13157 559
187 3300042594 Ga0466694_123440 Ga0466694_123440_5512_7218 559
188 3300042594 Ga0466694_339539 Ga0466694_339539_1646_3370 559
189 3300042597 Ga0466699_265912 Ga0466699_265912_6255_7958 561
190 3300042619 Ga0466726_328179 Ga0466726_328179_6948_8753 561
191 3300042636 Ga0466703_320400 Ga0466703_320400_6427_8163 561
192 3300005201 Ga0072941_1037413 Ga0072941_10374135 562
193 3300042593 Ga0466691_158280 Ga0466691_158280_214_1923 562
194 3300042643 Ga0466704_055823 Ga0466704_055823_3672_5402 563
195 3300002450 JGI24695J34938_10021187 JGI24695J34938_100211872 564
196 3300042594 Ga0466694_273428 Ga0466694_273428_2943_4658 564
197 3300002449 JGI24698J34947_10040387 JGI24698J34947_100403872 566
198 3300042636 Ga0466703_113663 Ga0466703_113663_1465_3165 566
199 iso_pr_bacteria 2781125640 2781288090 567
200 3300042594 Ga0466694_086692 Ga0466694_086692_7813_9519 568
201 3300042609 Ga0466722_081727 Ga0466722_081727_31306_33012 568
202 3300042614 Ga0466712_024790 Ga0466712_024790_6346_8052 568
203 3300042636 Ga0466703_046739 Ga0466703_046739_7620_9326 568
204 iso_pr_bacteria 2781125640 2781287699 568
205 iso_pr_bacteria 2781125652 2781311588 568
206 iso_pr_bacteria 2781125657 2781323605 568
207 iso_pr_bacteria 2781125660 2781330243 568
208 iso_pr_bacteria 2781125665 2781341114 568
209 iso_pr_bacteria 2781125666 2781343558 568
210 iso_pr_bacteria 2781125688 2781424331 568
211 3300042614 Ga0466712_132504 Ga0466712_132504_24_1739 571
212 3300042590 Ga0466690_245723 Ga0466690_245723_1180_2898 572
213 3300042605 Ga0466716_424797 Ga0466716_424797_2230_3948 572
214 3300042609 Ga0466722_164986 Ga0466722_164986_3515_5233 572
215 3300042612 Ga0466705_193582 Ga0466705_193582_203_1924 573
216 3300042643 Ga0466704_095694 Ga0466704_095694_919_2640 573
217 3300042591 Ga0466692_190486 Ga0466692_190486_2466_4190 574
218 3300042607 Ga0466720_041453 Ga0466720_041453_28726_30450 574
219 3300042593 Ga0466691_170012 Ga0466691_170012_34816_36543 575
220 3300042596 Ga0466696_264178 Ga0466696_264178_1898_3628 576
221 3300042643 Ga0466704_070672 Ga0466704_070672_4789_6666 580

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 385 531 0.93
PF02463 SMC_N RecF/RecN/SMC N terminal domain 478 574 0.64

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.