Protein Family IF09330
Metagenome
Isolate
131
Members
56
Samples
124
Scaffolds
212.11
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_063074|Ga0466704_063074_508_1176
- Length
- 222 aa
- Sequence
- MITVKQFTFNFLEENTYLLYDETKEAVLIDCGCITPDEENTLSGFIDKNSLTLKKLLSTHYHFDHVIGNACIFHKYGIRPEIHRGEKNVHTPTLNMQASKFGISMSFEEIEPLRNIEDNEEIHFGHSVLKALLVPGHSPASLAFYSEADKLIFAGDVLFSGSIGRTDLWGGDYDTLIKSIKTRLLTLPDETVVYPGHGPSTTIGAEKTDNPYFSSQTSTKAL
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.2%
Kalotermitidae
25.9%
Blattidae
11.1%
Unclassified
7.4%
Termopsidae
7.4%
Rhinotermitidae
5.6%
Passalidae
5.6%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 7 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 31 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 50 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466714_080998 | 3300042603 | Bacteria | 1291 |
| 2 | Ga0466725_365748 | 3300042654 | Bacteria | 104297 |
| 3 | Ga0466715_119859 | 3300042616 | Bacteria | 19632 |
| 4 | Ga0466718_160318 | 3300042617 | Bacteria | 2960 |
| 5 | Ga0466690_023696 | 3300042590 | Bacteria | 23811 |
| 6 | Ga0466691_084757 | 3300042593 | Bacteria | 6378 |
| 7 | 2227172476 | 2225789004 | Unclassified | 8181 |
| 8 | Ga0072940_1436979 | 3300005200 | Bacteria | 766 |
| 9 | Ga0123354_10099946 | 3300010882 | Bacteria | 3931 |
| 10 | Ga0466705_100268 | 3300042612 | Bacteria | 14782 |
| 11 | Ga0466719_043632 | 3300042606 | Bacteria | 9611 |
| 12 | Ga0466719_311507 | 3300042606 | Bacteria | 11845 |
| 13 | Ga0466704_115958 | 3300042643 | Bacteria | 4356 |
| 14 | Ga0466711_114294 | 3300042615 | Bacteria | 16823 |
| 15 | Ga0466715_122804 | 3300042616 | Bacteria | 8013 |
| 16 | Ga0466726_268586 | 3300042619 | Bacteria | 3632 |
| 17 | Ga0466726_410735 | 3300042619 | Bacteria | 1228 |
| 18 | Ga0265387_1011106 | 3300024582 | Bacteria | 1234 |
| 19 | 2227130795 | 2225789004 | Bacteria | 8982 |
| 20 | IMNBL1DRAFT_c0004210 | 3300000062 | Bacteria | 8739 |
| 21 | Ga0072941_1274611 | 3300005201 | Bacteria | 2713 |
| 22 | Ga0466703_248660 | 3300042636 | Bacteria | 6300 |
| 23 | Ga0466704_293340 | 3300042643 | Bacteria | 21702 |
| 24 | Ga0466709_321807 | 3300042648 | Bacteria | 4623 |
| 25 | Ga0466711_231782 | 3300042615 | Bacteria | 8922 |
| 26 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 27 | Ga0466692_155247 | 3300042591 | Bacteria | 29198 |
| 28 | Ga0466693_438675 | 3300042592 | Bacteria | 1659 |
| 29 | Ga0466691_051621 | 3300042593 | Bacteria | 8516 |
| 30 | Ga0466691_113066 | 3300042593 | Bacteria | 9717 |
| 31 | Ga0466696_442166 | 3300042596 | Bacteria | 1277 |
| 32 | 2227485743 | 2225789004 | Bacteria | 21441 |
| 33 | JGI24702J35022_10004249 | 3300002462 | Bacteria | 8550 |
| 34 | Ga0068305_10042886 | 3300005083 | Bacteria | 6888 |
| 35 | Ga0068305_10051634 | 3300005083 | Unclassified | 5543 |
| 36 | Ga0466732_056474 | 3300042656 | Bacteria | 3068 |
| 37 | Ga0466707_421380 | 3300042601 | Bacteria | 4682 |
| 38 | Ga0466713_092539 | 3300042602 | Bacteria | 79640 |
| 39 | Ga0466716_165629 | 3300042605 | Bacteria | 14714 |
| 40 | Ga0466722_015255 | 3300042609 | Bacteria | 47931 |
| 41 | Ga0466722_209146 | 3300042609 | Bacteria | 12358 |
| 42 | Ga0466722_226889 | 3300042609 | Bacteria | 6161 |
| 43 | Ga0466703_222891 | 3300042636 | Bacteria | 9444 |
| 44 | Ga0466703_277710 | 3300042636 | Bacteria | 8547 |
| 45 | Ga0466711_144241 | 3300042615 | Bacteria | 3800 |
| 46 | Ga0466715_208000 | 3300042616 | Bacteria | 5910 |
| 47 | Ga0466690_047538 | 3300042590 | Bacteria | 16584 |
| 48 | Ga0466692_167706 | 3300042591 | Bacteria | 2576 |
| 49 | Ga0466693_287481 | 3300042592 | Bacteria | 2847 |
| 50 | Ga0466694_334906 | 3300042594 | Bacteria | 1490 |
| 51 | Ga0466696_224220 | 3300042596 | Bacteria | 4604 |
| 52 | IMNBL1DRAFT_c0003081 | 3300000062 | Bacteria | 11003 |
| 53 | JGI24705J35276_12203848 | 3300002504 | Bacteria | 1665 |
| 54 | JGI24705J35276_12219402 | 3300002504 | Bacteria | 2203 |
| 55 | Ga0123357_10004340 | 3300009784 | Bacteria | 16620 |
| 56 | Ga0466697_164988 | 3300042611 | Bacteria | 1372 |
| 57 | Ga0466705_097295 | 3300042612 | Unclassified | 1062 |
| 58 | Ga0466700_159867 | 3300042600 | Bacteria | 18678 |
| 59 | Ga0466707_111724 | 3300042601 | Bacteria | 1606 |
| 60 | Ga0466704_551282 | 3300042643 | Bacteria | 3028 |
| 61 | Ga0466710_076999 | 3300042613 | Bacteria | 1628 |
| 62 | Ga0466715_343918 | 3300042616 | Bacteria | 61776 |
| 63 | Ga0466726_377930 | 3300042619 | Bacteria | 1261 |
| 64 | Ga0466696_024325 | 3300042596 | Bacteria | 7800 |
| 65 | Ga0466696_066676 | 3300042596 | Bacteria | 1076 |
| 66 | Ga0466696_124171 | 3300042596 | Bacteria | 8996 |
| 67 | 2227473466 | 2225789004 | Bacteria | 905 |
| 68 | IMNBL1DRAFT_c0001022 | 3300000062 | Bacteria | 21613 |
| 69 | IMNBL1DRAFT_c0004583 | 3300000062 | Bacteria | 8239 |
| 70 | Ga0466697_191368 | 3300042611 | Bacteria | 1536 |
| 71 | Ga0466733_064172 | 3300042659 | Bacteria | 8043 |
| 72 | Ga0466706_167204 | 3300042599 | Bacteria | 7392 |
| 73 | Ga0466707_033897 | 3300042601 | Bacteria | 3831 |
| 74 | Ga0466707_084833 | 3300042601 | Bacteria | 2227 |
| 75 | Ga0466713_024194 | 3300042602 | Bacteria | 6215 |
| 76 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 77 | Ga0466719_454420 | 3300042606 | Bacteria | 2700 |
| 78 | Ga0466698_214566 | 3300042610 | Bacteria | 1469 |
| 79 | Ga0466704_260653 | 3300042643 | Bacteria | 1179 |
| 80 | Ga0466727_045206 | 3300042655 | Bacteria | 7019 |
| 81 | Ga0466727_174137 | 3300042655 | Bacteria | 3924 |
| 82 | Ga0466711_130686 | 3300042615 | Bacteria | 7394 |
| 83 | Ga0466723_042738 | 3300042618 | Bacteria | 46355 |
| 84 | Ga0466729_052232 | 3300042621 | Bacteria | 2033 |
| 85 | Ga0466696_345561 | 3300042596 | Bacteria | 8211 |
| 86 | 2227097475 | 2225789004 | Bacteria | 9694 |
| 87 | 2227278020 | 2225789004 | Bacteria | 6838 |
| 88 | 2227480102 | 2225789004 | Bacteria | 855 |
| 89 | IMNBL1DRAFT_c0003022 | 3300000062 | Bacteria | 11133 |
| 90 | IMNBL1DRAFT_c0012241 | 3300000062 | Bacteria | 3939 |
| 91 | JGI24696J40584_12902103 | 3300002834 | Bacteria | 1192 |
| 92 | Ga0068305_10009518 | 3300005083 | Bacteria | 1035 |
| 93 | Ga0466705_111900 | 3300042612 | Bacteria | 5766 |
| 94 | Ga0466705_157917 | 3300042612 | Bacteria | 7944 |
| 95 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 96 | Ga0466701_035971 | 3300042598 | Bacteria | 18774 |
| 97 | Ga0466707_207401 | 3300042601 | Bacteria | 49643 |
| 98 | Ga0466713_115337 | 3300042602 | Bacteria | 64305 |
| 99 | Ga0466716_000365 | 3300042605 | Bacteria | 17966 |
| 100 | Ga0466716_369243 | 3300042605 | Bacteria | 6978 |
| 101 | Ga0466704_063074 | 3300042643 | Bacteria | 10856 |
| 102 | Ga0466709_156301 | 3300042648 | Bacteria | 1857 |
| 103 | Ga0466711_389983 | 3300042615 | Bacteria | 28531 |
| 104 | Ga0466728_051221 | 3300042620 | Bacteria | 8656 |
| 105 | Ga0466699_202698 | 3300042597 | Bacteria | 2059 |
| 106 | 2227647707 | 2225789004 | Bacteria | 2020 |
| 107 | Ga0068302_10090448 | 3300005071 | Bacteria | 5399 |
| 108 | Ga0068305_10005570 | 3300005083 | Bacteria | 4095 |
| 109 | Ga0466727_348922 | 3300042655 | Bacteria | 1372 |
| 110 | Ga0466733_015565 | 3300042659 | Bacteria | 17314 |
| 111 | Ga0466719_343119 | 3300042606 | Bacteria | 1374 |
| 112 | Ga0466729_273444 | 3300042621 | Bacteria | 8969 |
| 113 | Ga0466735_057015 | 3300042624 | Bacteria | 1124 |
| 114 | Ga0466704_479213 | 3300042643 | Bacteria | 10932 |
| 115 | Ga0466704_534735 | 3300042643 | Bacteria | 7273 |
| 116 | Ga0466709_060807 | 3300042648 | Bacteria | 7358 |
| 117 | Ga0466708_172342 | 3300042652 | Bacteria | 21087 |
| 118 | Ga0466725_424926 | 3300042654 | Bacteria | 16625 |
| 119 | Ga0466727_008661 | 3300042655 | Bacteria | 5716 |
| 120 | Ga0466690_104588 | 3300042590 | Bacteria | 10613 |
| 121 | Ga0466696_051573 | 3300042596 | Bacteria | 10685 |
| 122 | 2227008133 | 2225789003 | Bacteria | 27701 |
| 123 | Ga0068302_10008664 | 3300005071 | Bacteria | 2350 |
| 124 | Ga0068305_10310418 | 3300005083 | Bacteria | 7027 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10005570 | Ga0068305_100055702 | 172 |
| 2 | 3300042600 | Ga0466700_159867 | Ga0466700_159867_11915_12547 | 185 |
| 3 | 3300042615 | Ga0466711_231782 | Ga0466711_231782_3896_4528 | 191 |
| 4 | 3300042590 | Ga0466690_047538 | Ga0466690_047538_3550_4188 | 195 |
| 5 | 3300042605 | Ga0466716_369243 | Ga0466716_369243_3386_4024 | 196 |
| 6 | 2225789004 | 2227172476 | 2227587194 | 199 |
| 7 | 2225789004 | 2227130795 | 2227527704 | 201 |
| 8 | 3300000062 | IMNBL1DRAFT_c0004583 | IMNBL1DRAFT_00045834 | 203 |
| 9 | 3300042611 | Ga0466697_191368 | Ga0466697_191368_271_891 | 206 |
| 10 | 3300042655 | Ga0466727_045206 | Ga0466727_045206_4642_5262 | 206 |
| 11 | 2225789004 | 2227480102 | 2227937126 | 210 |
| 12 | 3300002462 | JGI24702J35022_10004249 | JGI24702J35022_100042492 | 210 |
| 13 | 3300042591 | Ga0466692_155247 | Ga0466692_155247_10489_11121 | 210 |
| 14 | 3300000062 | IMNBL1DRAFT_c0004210 | IMNBL1DRAFT_00042105 | 211 |
| 15 | 3300042621 | Ga0466729_273444 | Ga0466729_273444_4409_5044 | 211 |
| 16 | 3300042643 | Ga0466704_479213 | Ga0466704_479213_5558_6229 | 211 |
| 17 | iso_pr_bacteria | 2940199050 | 2940201466 | 211 |
| 18 | iso_pr_bacteria | 2940209341 | 2940212397 | 211 |
| 19 | iso_pr_bacteria | 2940346213 | 2940348088 | 211 |
| 20 | 2225789003 | 2227008133 | 2227364981 | 212 |
| 21 | 2225789004 | 2227097475 | 2227479373 | 212 |
| 22 | 2225789004 | 2227485743 | 2227951479 | 212 |
| 23 | 2225789004 | 2227647707 | 2228241662 | 212 |
| 24 | 3300002834 | JGI24696J40584_12902103 | JGI24696J40584_129021032 | 212 |
| 25 | 3300024582 | Ga0265387_1011106 | Ga0265387_10111062 | 212 |
| 26 | 3300042592 | Ga0466693_438675 | Ga0466693_438675_668_1306 | 212 |
| 27 | 3300042593 | Ga0466691_084757 | Ga0466691_084757_3881_4519 | 212 |
| 28 | 3300042594 | Ga0466694_334906 | Ga0466694_334906_759_1397 | 212 |
| 29 | 3300042598 | Ga0466701_035971 | Ga0466701_035971_15238_15876 | 212 |
| 30 | 3300042601 | Ga0466707_421380 | Ga0466707_421380_159_797 | 212 |
| 31 | 3300042602 | Ga0466713_024194 | Ga0466713_024194_1900_2538 | 212 |
| 32 | 3300042602 | Ga0466713_092539 | Ga0466713_092539_48626_49264 | 212 |
| 33 | 3300042603 | Ga0466714_080998 | Ga0466714_080998_481_1119 | 212 |
| 34 | 3300042605 | Ga0466716_000365 | Ga0466716_000365_12020_12658 | 212 |
| 35 | 3300042606 | Ga0466719_343119 | Ga0466719_343119_452_1090 | 212 |
| 36 | 3300042609 | Ga0466722_015255 | Ga0466722_015255_17774_18412 | 212 |
| 37 | 3300042609 | Ga0466722_209146 | Ga0466722_209146_6452_7090 | 212 |
| 38 | 3300042609 | Ga0466722_226889 | Ga0466722_226889_4312_4950 | 212 |
| 39 | 3300042610 | Ga0466698_214566 | Ga0466698_214566_742_1380 | 212 |
| 40 | 3300042611 | Ga0466697_164988 | Ga0466697_164988_76_714 | 212 |
| 41 | 3300042612 | Ga0466705_097295 | Ga0466705_097295_171_809 | 212 |
| 42 | 3300042612 | Ga0466705_111900 | Ga0466705_111900_4071_4709 | 212 |
| 43 | 3300042615 | Ga0466711_130686 | Ga0466711_130686_4783_5421 | 212 |
| 44 | 3300042615 | Ga0466711_144241 | Ga0466711_144241_3034_3672 | 212 |
| 45 | 3300042616 | Ga0466715_119859 | Ga0466715_119859_7292_7930 | 212 |
| 46 | 3300042616 | Ga0466715_343918 | Ga0466715_343918_23659_24297 | 212 |
| 47 | 3300042617 | Ga0466718_160318 | Ga0466718_160318_846_1484 | 212 |
| 48 | 3300042619 | Ga0466726_410735 | Ga0466726_410735_82_720 | 212 |
| 49 | 3300042621 | Ga0466729_052232 | Ga0466729_052232_261_899 | 212 |
| 50 | 3300042636 | Ga0466703_248660 | Ga0466703_248660_4275_4913 | 212 |
| 51 | 3300042643 | Ga0466704_293340 | Ga0466704_293340_15445_16083 | 212 |
| 52 | 3300042648 | Ga0466709_060807 | Ga0466709_060807_4602_5240 | 212 |
| 53 | 3300042648 | Ga0466709_156301 | Ga0466709_156301_797_1435 | 212 |
| 54 | 3300042648 | Ga0466709_321807 | Ga0466709_321807_3439_4077 | 212 |
| 55 | 3300042654 | Ga0466725_424926 | Ga0466725_424926_9951_10589 | 212 |
| 56 | 3300042655 | Ga0466727_348922 | Ga0466727_348922_221_859 | 212 |
| 57 | 3300042656 | Ga0466732_056474 | Ga0466732_056474_2315_2953 | 212 |
| 58 | 3300042659 | Ga0466733_025416 | Ga0466733_025416_127485_128123 | 212 |
| 59 | 3300042659 | Ga0466733_064172 | Ga0466733_064172_3583_4221 | 212 |
| 60 | iso_pr_bacteria | 2820778767 | 2820780355 | 212 |
| 61 | iso_pr_bacteria | 2940195863 | 2940196289 | 212 |
| 62 | iso_pr_bacteria | 2940202316 | 2940204280 | 212 |
| 63 | iso_pr_bacteria | 2940306115 | 2940307447 | 212 |
| 64 | 2225789004 | 2227278020 | 2227729708 | 213 |
| 65 | 2225789004 | 2227473466 | 2227922386 | 213 |
| 66 | 3300000062 | IMNBL1DRAFT_c0001022 | IMNBL1DRAFT_00010224 | 213 |
| 67 | 3300000062 | IMNBL1DRAFT_c0003081 | IMNBL1DRAFT_00030813 | 213 |
| 68 | 3300002504 | JGI24705J35276_12203848 | JGI24705J35276_122038482 | 213 |
| 69 | 3300002504 | JGI24705J35276_12219402 | JGI24705J35276_122194022 | 213 |
| 70 | 3300005071 | Ga0068302_10090448 | Ga0068302_100904485 | 213 |
| 71 | 3300005200 | Ga0072940_1436979 | Ga0072940_14369791 | 213 |
| 72 | 3300005201 | Ga0072941_1274611 | Ga0072941_12746113 | 213 |
| 73 | 3300009784 | Ga0123357_10004340 | Ga0123357_100043406 | 213 |
| 74 | 3300010882 | Ga0123354_10099946 | Ga0123354_100999462 | 213 |
| 75 | 3300042590 | Ga0466690_023696 | Ga0466690_023696_767_1408 | 213 |
| 76 | 3300042590 | Ga0466690_104588 | Ga0466690_104588_1275_1916 | 213 |
| 77 | 3300042593 | Ga0466691_051621 | Ga0466691_051621_6820_7461 | 213 |
| 78 | 3300042596 | Ga0466696_024325 | Ga0466696_024325_1520_2161 | 213 |
| 79 | 3300042596 | Ga0466696_051573 | Ga0466696_051573_1600_2241 | 213 |
| 80 | 3300042596 | Ga0466696_345561 | Ga0466696_345561_6659_7300 | 213 |
| 81 | 3300042597 | Ga0466699_202698 | Ga0466699_202698_1139_1780 | 213 |
| 82 | 3300042601 | Ga0466707_033897 | Ga0466707_033897_1169_1810 | 213 |
| 83 | 3300042601 | Ga0466707_084833 | Ga0466707_084833_476_1117 | 213 |
| 84 | 3300042605 | Ga0466716_165629 | Ga0466716_165629_6928_7569 | 213 |
| 85 | 3300042606 | Ga0466719_311507 | Ga0466719_311507_1678_2319 | 213 |
| 86 | 3300042612 | Ga0466705_157917 | Ga0466705_157917_776_1417 | 213 |
| 87 | 3300042613 | Ga0466710_076999 | Ga0466710_076999_888_1529 | 213 |
| 88 | 3300042618 | Ga0466723_033742 | Ga0466723_033742_19125_19766 | 213 |
| 89 | 3300042618 | Ga0466723_042738 | Ga0466723_042738_42069_42710 | 213 |
| 90 | 3300042620 | Ga0466728_051221 | Ga0466728_051221_1269_1910 | 213 |
| 91 | 3300042636 | Ga0466703_222891 | Ga0466703_222891_5939_6580 | 213 |
| 92 | 3300042643 | Ga0466704_115958 | Ga0466704_115958_3151_3792 | 213 |
| 93 | 3300042643 | Ga0466704_260653 | Ga0466704_260653_231_872 | 213 |
| 94 | 3300042643 | Ga0466704_534735 | Ga0466704_534735_439_1080 | 213 |
| 95 | 3300042659 | Ga0466733_015565 | Ga0466733_015565_8767_9408 | 213 |
| 96 | 3300000062 | IMNBL1DRAFT_c0012241 | IMNBL1DRAFT_00122414 | 214 |
| 97 | 3300005083 | Ga0068305_10009518 | Ga0068305_100095182 | 214 |
| 98 | 3300042591 | Ga0466692_167706 | Ga0466692_167706_1669_2313 | 214 |
| 99 | 3300042592 | Ga0466693_287481 | Ga0466693_287481_2116_2760 | 214 |
| 100 | 3300042596 | Ga0466696_124171 | Ga0466696_124171_6201_6845 | 214 |
| 101 | 3300042602 | Ga0466713_032013 | Ga0466713_032013_58365_59009 | 214 |
| 102 | 3300042606 | Ga0466719_043632 | Ga0466719_043632_539_1183 | 214 |
| 103 | 3300042606 | Ga0466719_454420 | Ga0466719_454420_695_1339 | 214 |
| 104 | 3300042616 | Ga0466715_122804 | Ga0466715_122804_2676_3320 | 214 |
| 105 | 3300000062 | IMNBL1DRAFT_c0003022 | IMNBL1DRAFT_00030222 | 215 |
| 106 | 3300005083 | Ga0068305_10051634 | Ga0068305_100516342 | 215 |
| 107 | 3300042602 | Ga0466713_115337 | Ga0466713_115337_26431_27078 | 215 |
| 108 | 3300042612 | Ga0466705_100268 | Ga0466705_100268_3093_3740 | 215 |
| 109 | 3300042615 | Ga0466711_389983 | Ga0466711_389983_18481_19128 | 215 |
| 110 | 3300042619 | Ga0466726_268586 | Ga0466726_268586_322_969 | 215 |
| 111 | 3300042624 | Ga0466735_057015 | Ga0466735_057015_135_782 | 215 |
| 112 | 3300042652 | Ga0466708_172342 | Ga0466708_172342_17147_17794 | 215 |
| 113 | 3300005083 | Ga0068305_10310418 | Ga0068305_103104185 | 216 |
| 114 | 3300042596 | Ga0466696_066676 | Ga0466696_066676_12_662 | 216 |
| 115 | 3300042596 | Ga0466696_224220 | Ga0466696_224220_2206_2856 | 216 |
| 116 | 3300042599 | Ga0466706_167204 | Ga0466706_167204_5183_5833 | 216 |
| 117 | 3300042616 | Ga0466715_208000 | Ga0466715_208000_2672_3322 | 216 |
| 118 | 3300042643 | Ga0466704_551282 | Ga0466704_551282_1256_1906 | 216 |
| 119 | 3300042655 | Ga0466727_008661 | Ga0466727_008661_2340_2990 | 216 |
| 120 | 3300042655 | Ga0466727_174137 | Ga0466727_174137_1360_2010 | 216 |
| 121 | 3300005071 | Ga0068302_10008664 | Ga0068302_100086642 | 217 |
| 122 | 3300042596 | Ga0466696_442166 | Ga0466696_442166_19_672 | 217 |
| 123 | 3300042601 | Ga0466707_111724 | Ga0466707_111724_205_861 | 218 |
| 124 | 3300005083 | Ga0068305_10042886 | Ga0068305_100428865 | 219 |
| 125 | 3300042601 | Ga0466707_207401 | Ga0466707_207401_29728_30387 | 219 |
| 126 | 3300042654 | Ga0466725_365748 | Ga0466725_365748_6972_7631 | 219 |
| 127 | 3300042636 | Ga0466703_277710 | Ga0466703_277710_6481_7146 | 221 |
| 128 | 3300042593 | Ga0466691_113066 | Ga0466691_113066_617_1285 | 222 |
| 129 | 3300042615 | Ga0466711_114294 | Ga0466711_114294_6030_6698 | 222 |
| 130 | 3300042619 | Ga0466726_377930 | Ga0466726_377930_267_953 | 222 |
| 131 | 3300042643 | Ga0466704_063074 | Ga0466704_063074_508_1176 | 222 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00753 | Lactamase_B | Metallo-beta-lactamase superfamily | 14 | 197 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.93 | 0.95 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.