Protein Family IF09328

Metagenome Isolate
141 Members
55 Samples
123 Scaffolds
159.18 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_059052|Ga0466704_059052_7580_8113
Length
177 aa
Sequence
MLVAITGKNGCRMTEYRNMKISKTNAARLLDQAKIVYELIPYRFDENDLSASHVAEALNEPLEQVFKTLVLKGDRSGYFVCVVPGDSEVDLKKAAKVSGNKNCDLIPQKNLLPLTGYVRGGCSPVGMKKHFPAYIHETCLLYASVFVSAGQRGLQMKIGTEDLIKIANAETVDLIVG

📊 Sample Types

Isolate 12.8%
Metagenome 87.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.8%
Kalotermitidae 21.8%
Blattidae 16.4%
Unclassified 12.7%
Rhinotermitidae 7.3%
Termopsidae 5.5%
Hydrophilidae 3.6%
Apidae 3.6%
Passalidae 3.6%
Drosophilidae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
17 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
18 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
19 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
24 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300005314 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut Metagenome Drosophilidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2832343623 Apibacter adventoris wkB180 Isolate Apidae
33 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2832372155 Apibacter adventoris wkB301 Isolate Apidae
42 2920168565 Paludibacter sp. 221 Isolate Blattidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
46 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
47 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
48 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
54 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
55 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_168122 3300042643 Bacteria 3617
2 Ga0466704_180446 3300042643 Bacteria 10940
3 Ga0466709_163478 3300042648 Bacteria 96467
4 Ga0123357_10572229 3300009784 Bacteria 886
5 Ga0466690_200085 3300042590 Bacteria 1466
6 Ga0466715_551394 3300042616 Bacteria 3063
7 Ga0466726_143648 3300042619 Bacteria 4406
8 Ga0466729_011387 3300042621 Bacteria 1533
9 Ga0466706_082024 3300042599 Bacteria 1438
10 Ga0466707_004874 3300042601 Bacteria 1529
11 Ga0466707_273817 3300042601 Bacteria 2104
12 Ga0466722_205395 3300042609 Bacteria 1253
13 Ga0466698_426451 3300042610 Bacteria 1949
14 Ga0074309_1118820 3300005314 Bacteria 822
15 Ga0466705_061537 3300042612 Bacteria 18963
16 Ga0466705_360619 3300042612 Bacteria 13364
17 Ga0466735_025723 3300042624 Bacteria 1939
18 Ga0466703_242860 3300042636 Bacteria 1092
19 Ga0466704_059052 3300042643 Bacteria 32672
20 Ga0466704_285232 3300042643 Bacteria 17633
21 Ga0466709_210699 3300042648 Bacteria 76873
22 Ga0466727_013485 3300042655 Bacteria 1729
23 Ga0123357_10047642 3300009784 Bacteria 5809
24 Ga0466691_134776 3300042593 Bacteria 15061
25 Ga0466701_012377 3300042598 Bacteria 1914
26 Ga0466715_045815 3300042616 Unclassified 2549
27 Ga0466707_079672 3300042601 Bacteria 29222
28 Ga0466707_093678 3300042601 Bacteria 1010
29 Ga0466707_228185 3300042601 Bacteria 1884
30 Ga0466713_141379 3300042602 Bacteria 226907
31 Ga0466705_299500 3300042612 Bacteria 3441
32 Ga0466704_048221 3300042643 Bacteria 5592
33 Ga0466709_325637 3300042648 Bacteria 2203
34 Ga0466690_071724 3300042590 Bacteria 1930
35 Ga0466690_207250 3300042590 Bacteria 9843
36 Ga0466729_013819 3300042621 Bacteria 11247
37 Ga0466706_105738 3300042599 Bacteria 2596
38 Ga0466706_261044 3300042599 Bacteria 12564
39 Ga0466707_411339 3300042601 Unclassified 2872
40 Ga0466713_027116 3300042602 Bacteria 2564
41 JGI24705J35276_12201952 3300002504 Bacteria 1628
42 Ga0466705_170176 3300042612 Bacteria 3471
43 Ga0466704_130981 3300042643 Bacteria 8146
44 Ga0466704_452328 3300042643 Bacteria 35059
45 Ga0123354_10796055 3300010882 Bacteria 638
46 Ga0466723_005571 3300042618 Bacteria 2755
47 Ga0466706_126249 3300042599 Bacteria 2682
48 Ga0466706_243505 3300042599 Bacteria 2152
49 Ga0466707_192770 3300042601 Bacteria 1301
50 Ga0466722_191367 3300042609 Bacteria 4712
51 Ga0068305_10155741 3300005083 Unclassified 2152
52 Ga0466705_034186 3300042612 Bacteria 2300
53 Ga0466735_002053 3300042624 Bacteria 5036
54 Ga0466703_208622 3300042636 Bacteria 3500
55 Ga0466704_122879 3300042643 Bacteria 10014
56 Ga0466704_308169 3300042643 Bacteria 15661
57 Ga0466727_284409 3300042655 Bacteria 3119
58 Ga0466692_189932 3300042591 Bacteria 1714
59 Ga0466696_071384 3300042596 Bacteria 9655
60 Ga0466711_019652 3300042615 Bacteria 2447
61 Ga0466715_011076 3300042616 Bacteria 39815
62 Ga0466715_159921 3300042616 Bacteria 1707
63 Ga0466715_218422 3300042616 Bacteria 20789
64 Ga0466726_461210 3300042619 Bacteria 2826
65 Ga0466707_011614 3300042601 Bacteria 1098
66 Ga0466707_028185 3300042601 Bacteria 3094
67 Ga0466707_366743 3300042601 Bacteria 2568
68 Ga0466714_011445 3300042603 Bacteria 1750
69 Ga0466705_320675 3300042612 Bacteria 2099
70 Ga0466735_028629 3300042624 Bacteria 4799
71 Ga0466703_243041 3300042636 Bacteria 1091
72 Ga0466704_291472 3300042643 Bacteria 8246
73 Ga0466709_090911 3300042648 Bacteria 33731
74 Ga0466727_056881 3300042655 Bacteria 1586
75 Ga0123357_10532105 3300009784 Bacteria 952
76 Ga0123357_10564849 3300009784 Bacteria 897
77 Ga0123353_10442501 3300010167 Bacteria 1917
78 Ga0123354_10302998 3300010882 Bacteria 1508
79 Ga0466690_017646 3300042590 Bacteria 34395
80 Ga0466726_258462 3300042619 Bacteria 3430
81 Ga0466707_010317 3300042601 Bacteria 15926
82 Ga0466707_364849 3300042601 Bacteria 16645
83 Ga0466716_004607 3300042605 Bacteria 6758
84 Ga0466719_025364 3300042606 Bacteria 1080
85 2227505197 2225789004 Bacteria 3702
86 Ga0466705_044800 3300042612 Bacteria 6833
87 Ga0466733_188403 3300042659 Bacteria 1458
88 Ga0466730_036149 3300042625 Bacteria 7760
89 Ga0466727_244603 3300042655 Bacteria 2987
90 Ga0123357_10395989 3300009784 Bacteria 1263
91 Ga0123354_10699160 3300010882 Bacteria 709
92 Ga0415639_098109 3300038395 Bacteria 1607
93 Ga0466696_174816 3300042596 Bacteria 2016
94 Ga0466715_423066 3300042616 Bacteria 29716
95 Ga0466723_048235 3300042618 Bacteria 8825
96 Ga0466726_004770 3300042619 Bacteria 1367
97 Ga0466706_040632 3300042599 Bacteria 1020
98 Ga0466706_237429 3300042599 Bacteria 4331
99 Ga0466706_254080 3300042599 Bacteria 2481
100 Ga0466707_184627 3300042601 Bacteria 3718
101 Ga0466707_242618 3300042601 Bacteria 1837
102 Ga0466707_396908 3300042601 Bacteria 5524
103 Ga0466713_008802 3300042602 Bacteria 69616
104 Ga0466722_095138 3300042609 Bacteria 1310
105 Ga0466698_075839 3300042610 Bacteria 1816
106 Ga0466698_229593 3300042610 Bacteria 2070
107 IMNBL1DRAFT_c0000875 3300000062 Bacteria 23483
108 Ga0466697_134277 3300042611 Bacteria 1499
109 Ga0466705_090603 3300042612 Bacteria 27210
110 Ga0466733_149641 3300042659 Bacteria 18486
111 Ga0466735_033396 3300042624 Bacteria 13871
112 Ga0466703_095600 3300042636 Bacteria 9992
113 Ga0466709_052404 3300042648 Bacteria 1326
114 Ga0466727_302605 3300042655 Bacteria 1550
115 Ga0123357_10315522 3300009784 Bacteria 1553
116 Ga0123357_10410489 3300009784 Bacteria 1221
117 Ga0466723_082320 3300042618 Bacteria 2277
118 Ga0466707_234650 3300042601 Bacteria 1664
119 Ga0466707_309381 3300042601 Bacteria 29890
120 Ga0466722_010370 3300042609 Bacteria 3678
121 Ga0466698_471047 3300042610 Bacteria 1868
122 IMNBL1DRAFT_c0000093 3300000062 Bacteria 77928
123 JGI24702J35022_10013953 3300002462 Bacteria 4440

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_273817 Ga0466707_273817_29_472 147
2 3300042609 Ga0466722_205395 Ga0466722_205395_783_1229 148
3 3300042601 Ga0466707_411339 Ga0466707_411339_637_1086 149
4 3300042616 Ga0466715_423066 Ga0466715_423066_7035_7484 149
5 3300042648 Ga0466709_210699 Ga0466709_210699_58337_58786 149
6 3300042601 Ga0466707_028185 Ga0466707_028185_746_1198 150
7 3300042601 Ga0466707_309381 Ga0466707_309381_14266_14718 150
8 3300042619 Ga0466726_461210 Ga0466726_461210_416_868 150
9 3300042609 Ga0466722_191367 Ga0466722_191367_1833_2288 151
10 3300038395 Ga0415639_098109 Ga0415639_098109_670_1134 154
11 3300042624 Ga0466735_033396 Ga0466735_033396_3276_3740 154
12 3300042599 Ga0466706_040632 Ga0466706_040632_131_598 155
13 3300042624 Ga0466735_025723 Ga0466735_025723_295_762 155
14 3300042655 Ga0466727_284409 Ga0466727_284409_987_1454 155
15 iso_pr_bacteria 2781125697 2781443479 155
16 3300002462 JGI24702J35022_10013953 JGI24702J35022_100139535 156
17 3300042590 Ga0466690_017646 Ga0466690_017646_26118_26588 156
18 3300042593 Ga0466691_134776 Ga0466691_134776_12414_12884 156
19 3300042599 Ga0466706_254080 Ga0466706_254080_172_642 156
20 3300042601 Ga0466707_234650 Ga0466707_234650_64_534 156
21 3300042612 Ga0466705_034186 Ga0466705_034186_114_584 156
22 3300042619 Ga0466726_258462 Ga0466726_258462_2547_3017 156
23 3300042643 Ga0466704_122879 Ga0466704_122879_8572_9042 156
24 3300042648 Ga0466709_052404 Ga0466709_052404_407_877 156
25 3300009784 Ga0123357_10047642 Ga0123357_100476422 157
26 3300009784 Ga0123357_10532105 Ga0123357_105321052 157
27 3300009784 Ga0123357_10572229 Ga0123357_105722291 157
28 3300010882 Ga0123354_10796055 Ga0123354_107960552 157
29 3300042590 Ga0466690_200085 Ga0466690_200085_889_1362 157
30 3300042596 Ga0466696_071384 Ga0466696_071384_6673_7146 157
31 3300042596 Ga0466696_174816 Ga0466696_174816_620_1093 157
32 3300042598 Ga0466701_012377 Ga0466701_012377_632_1105 157
33 3300042601 Ga0466707_004874 Ga0466707_004874_468_941 157
34 3300042601 Ga0466707_079672 Ga0466707_079672_1109_1582 157
35 3300042601 Ga0466707_093678 Ga0466707_093678_279_752 157
36 3300042601 Ga0466707_184627 Ga0466707_184627_634_1107 157
37 3300042601 Ga0466707_364849 Ga0466707_364849_2830_3303 157
38 3300042601 Ga0466707_396908 Ga0466707_396908_546_1019 157
39 3300042602 Ga0466713_027116 Ga0466713_027116_202_675 157
40 3300042605 Ga0466716_004607 Ga0466716_004607_243_716 157
41 3300042606 Ga0466719_025364 Ga0466719_025364_314_787 157
42 3300042610 Ga0466698_075839 Ga0466698_075839_1179_1652 157
43 3300042610 Ga0466698_229593 Ga0466698_229593_1309_1782 157
44 3300042610 Ga0466698_471047 Ga0466698_471047_595_1068 157
45 3300042616 Ga0466715_045815 Ga0466715_045815_186_659 157
46 3300042618 Ga0466723_048235 Ga0466723_048235_7246_7719 157
47 3300042618 Ga0466723_082320 Ga0466723_082320_1447_1920 157
48 3300042619 Ga0466726_004770 Ga0466726_004770_869_1342 157
49 3300042621 Ga0466729_013819 Ga0466729_013819_7239_7712 157
50 3300042624 Ga0466735_002053 Ga0466735_002053_2565_3038 157
51 3300042655 Ga0466727_056881 Ga0466727_056881_1102_1575 157
52 3300042655 Ga0466727_244603 Ga0466727_244603_863_1336 157
53 iso_pr_bacteria 2910930387 2910932390 157
54 iso_pr_bacteria 2920168565 2920169498 157
55 2225789004 2227505197 2227992312 158
56 3300002504 JGI24705J35276_12201952 JGI24705J35276_122019522 158
57 3300009784 Ga0123357_10315522 Ga0123357_103155222 158
58 3300009784 Ga0123357_10395989 Ga0123357_103959892 158
59 3300009784 Ga0123357_10564849 Ga0123357_105648492 158
60 3300010167 Ga0123353_10442501 Ga0123353_104425012 158
61 3300010882 Ga0123354_10302998 Ga0123354_103029982 158
62 3300010882 Ga0123354_10699160 Ga0123354_106991601 158
63 3300042599 Ga0466706_082024 Ga0466706_082024_596_1072 158
64 3300042599 Ga0466706_105738 Ga0466706_105738_1514_1990 158
65 3300042599 Ga0466706_261044 Ga0466706_261044_1008_1484 158
66 3300042601 Ga0466707_192770 Ga0466707_192770_564_1040 158
67 3300042602 Ga0466713_141379 Ga0466713_141379_110967_111443 158
68 3300042603 Ga0466714_011445 Ga0466714_011445_346_822 158
69 3300042612 Ga0466705_061537 Ga0466705_061537_8562_9038 158
70 3300042612 Ga0466705_320675 Ga0466705_320675_703_1179 158
71 3300042621 Ga0466729_011387 Ga0466729_011387_352_828 158
72 3300042625 Ga0466730_036149 Ga0466730_036149_2239_2715 158
73 3300042648 Ga0466709_090911 Ga0466709_090911_32978_33454 158
74 3300042655 Ga0466727_013485 Ga0466727_013485_573_1049 158
75 iso_pr_bacteria 2910942425 2910947021 158
76 iso_pr_bacteria 2940244548 2940245322 158
77 iso_pr_bacteria 2940248789 2940249562 158
78 iso_pr_bacteria 2940253009 2940253672 158
79 iso_pr_bacteria 2940257232 2940257527 158
80 3300042599 Ga0466706_243505 Ga0466706_243505_424_903 159
81 3300042610 Ga0466698_426451 Ga0466698_426451_1147_1626 159
82 3300042612 Ga0466705_044800 Ga0466705_044800_522_1001 159
83 3300042612 Ga0466705_170176 Ga0466705_170176_813_1322 159
84 3300042624 Ga0466735_028629 Ga0466735_028629_1687_2166 159
85 3300042643 Ga0466704_291472 Ga0466704_291472_2652_3158 159
86 3300042643 Ga0466704_452328 Ga0466704_452328_9224_9703 159
87 iso_pr_bacteria 2910949487 2910952667 159
88 3300000062 IMNBL1DRAFT_c0000093 IMNBL1DRAFT_000009333 160
89 3300042601 Ga0466707_228185 Ga0466707_228185_401_883 160
90 3300042609 Ga0466722_010370 Ga0466722_010370_678_1160 160
91 3300042612 Ga0466705_090603 Ga0466705_090603_17807_18289 160
92 3300042616 Ga0466715_159921 Ga0466715_159921_572_1054 160
93 3300042636 Ga0466703_095600 Ga0466703_095600_9239_9721 160
94 3300042636 Ga0466703_208622 Ga0466703_208622_876_1358 160
95 3300042636 Ga0466703_242860 Ga0466703_242860_388_870 160
96 3300042636 Ga0466703_243041 Ga0466703_243041_390_872 160
97 3300042659 Ga0466733_188403 Ga0466733_188403_377_859 160
98 iso_pr_bacteria 2873600114 2873603494 160
99 iso_pr_bacteria 2873610414 2873613885 160
100 iso_pr_bacteria 2910926975 2910930255 160
101 3300009784 Ga0123357_10410489 Ga0123357_104104892 161
102 3300042590 Ga0466690_071724 Ga0466690_071724_1395_1880 161
103 3300042591 Ga0466692_189932 Ga0466692_189932_656_1141 161
104 3300042599 Ga0466706_126249 Ga0466706_126249_618_1103 161
105 3300042601 Ga0466707_010317 Ga0466707_010317_3309_3794 161
106 3300042609 Ga0466722_095138 Ga0466722_095138_149_634 161
107 3300042612 Ga0466705_299500 Ga0466705_299500_2779_3264 161
108 iso_pr_bacteria 2695420317 2695484140 161
109 iso_pr_bacteria 2740892557 2743952369 161
110 iso_pr_bacteria 2832343623 2832345807 161
111 iso_pr_bacteria 2832372155 2832372475 161
112 3300000062 IMNBL1DRAFT_c0000875 IMNBL1DRAFT_000087520 162
113 3300042599 Ga0466706_237429 Ga0466706_237429_75_563 162
114 3300042643 Ga0466704_308169 Ga0466704_308169_1028_1516 162
115 3300042655 Ga0466727_302605 Ga0466727_302605_138_626 162
116 iso_pr_bacteria 8100166142 8100166615 162
117 3300005083 Ga0068305_10155741 Ga0068305_101557412 163
118 3300042590 Ga0466690_207250 Ga0466690_207250_7066_7557 163
119 3300042616 Ga0466715_218422 Ga0466715_218422_15809_16300 163
120 3300042643 Ga0466704_048221 Ga0466704_048221_394_885 163
121 3300042643 Ga0466704_130981 Ga0466704_130981_6239_6730 163
122 3300042643 Ga0466704_180446 Ga0466704_180446_8481_8972 163
123 3300042659 Ga0466733_149641 Ga0466733_149641_148_639 163
124 3300005314 Ga0074309_1118820 Ga0074309_11188202 165
125 3300042602 Ga0466713_008802 Ga0466713_008802_68056_68553 165
126 3300042616 Ga0466715_011076 Ga0466715_011076_18676_19173 165
127 3300042618 Ga0466723_005571 Ga0466723_005571_1063_1560 165
128 3300042648 Ga0466709_163478 Ga0466709_163478_68101_68598 165
129 3300042612 Ga0466705_360619 Ga0466705_360619_12293_12793 166
130 3300042643 Ga0466704_168122 Ga0466704_168122_657_1157 166
131 3300042648 Ga0466709_325637 Ga0466709_325637_1024_1524 166
132 iso_pr_bacteria 2820201435 2820202222 166
133 3300042601 Ga0466707_011614 Ga0466707_011614_348_851 167
134 3300042611 Ga0466697_134277 Ga0466697_134277_393_896 167
135 3300042601 Ga0466707_242618 Ga0466707_242618_659_1165 168
136 3300042615 Ga0466711_019652 Ga0466711_019652_593_1105 170
137 3300042601 Ga0466707_366743 Ga0466707_366743_736_1254 172
138 3300042616 Ga0466715_551394 Ga0466715_551394_2354_2881 175
139 3300042619 Ga0466726_143648 Ga0466726_143648_2223_2750 175
140 3300042643 Ga0466704_285232 Ga0466704_285232_8739_9266 175
141 3300042643 Ga0466704_059052 Ga0466704_059052_7580_8113 177

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04073 tRNA_edit Aminoacyl-tRNA editing domain 50 165 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04073 GO:0002161 aminoacyl-tRNA editing activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.