Protein Family IF09321
Metagenome
Isolate
309
Members
247
Samples
130
Scaffolds
410.12
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_042237|Ga0466704_042237_14_1357
- Length
- 447 aa
- Sequence
- MWSVERKVSSEDVLKSAIHEERGQMREKRTFQLPGMTVALVLAGGRGSRLYELTDRRAKPAVYFGGKYRIVDFAMSNCVNSGIRRIGVVTQYKSHSLLRHIQRGWGFLRGEDNEFIDLLPAQQRVDEESWYRGTADAVYQNIDIIETFRPVPKYVLILAGDHVYKMNYAAMLVDHAESGAECTVACIEVPRRDAKGFGVMAVDESDRIVDFVEKPADPPAMPGKPESSLCSMGIYIFNAEYLYNELKRDIDDPTSSHDFGKDIIPQAVRNGVASAHSFDRSCVHAPEEGPNKENYWRDAGTVDAYWEANIDLTATDPALNLYDYNWPVWTYQQQLPPAKFVHNQIDRHGVAIESMVSGGCIISGELNRSLLFSSCRVHSYSRINWSVLLPQVEVGRNARLNRCVIDHGVFIPPGLVIGENPDEDARRFRRTGNGVILVTRQMIERLR
Sample Types
Isolate
57.9%
Metagenome
42.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
34.6%
Unclassified
22.9%
Termitidae
10.8%
Blattidae
5.2%
Kalotermitidae
5.2%
Armadillidiidae
2.2%
Culicidae
2.2%
Elmidae
2.2%
Ixodidae
1.7%
Drosophilidae
1.7%
Rhinotermitidae
1.3%
Palinuridae
1.3%
Tenebrionidae
1.3%
Termopsidae
1.3%
Argasidae
0.9%
Talitridae
0.9%
Passalidae
0.9%
Berytidae
0.9%
Nephropidae
0.4%
Daphniidae
0.4%
Hodotermitidae
0.4%
Artemiidae
0.4%
Alydidae
0.4%
Penaeidae
0.4%
Taxonomy
Archaea
0
Bacteria
293
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 2 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 3 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 4 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 5 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 6 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 7 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 8 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 9 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 10 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 11 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 12 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 13 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 19 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 20 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 21 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 22 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 23 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 24 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 25 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 26 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 27 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 28 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 29 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 30 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 31 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 32 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 33 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 34 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 35 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 36 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 41 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 42 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 43 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 44 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 45 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 46 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 47 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 48 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 49 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 50 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 51 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 52 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 53 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 54 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 55 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 56 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 57 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 58 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 59 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 60 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 61 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 62 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 63 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 64 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 65 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 66 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 67 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 70 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 71 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 72 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 73 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 74 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 75 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 76 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 77 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 78 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 79 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 80 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 81 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 82 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 83 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 84 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 85 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 88 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 89 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 90 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 91 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 92 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 93 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 94 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 95 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 96 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 97 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 98 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 99 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 100 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 101 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 102 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 103 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 104 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 105 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 106 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 107 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 108 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 109 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 110 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 111 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 112 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 113 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 114 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 115 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 116 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 117 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 118 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 119 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 120 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 121 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 122 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 123 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 124 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 125 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 126 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 127 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 128 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 129 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 130 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 131 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 132 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 133 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 134 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 135 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 136 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 137 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 138 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 139 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 140 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 141 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 142 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 143 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 144 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 145 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 146 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 147 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 148 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 149 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 150 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 151 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 152 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 153 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 154 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 155 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 156 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 157 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 158 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 159 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 160 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 161 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 162 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 163 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 164 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 165 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 166 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 167 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 168 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 169 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 170 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 171 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 172 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 173 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 174 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 175 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 176 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 177 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 178 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 179 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 180 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 181 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 182 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 183 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 184 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 185 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 186 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 187 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 188 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 189 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 190 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 191 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 192 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 193 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 194 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 195 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 196 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 197 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 198 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 199 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 200 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 201 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 202 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 203 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 204 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 205 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 206 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 207 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 208 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 209 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 210 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 211 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 212 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 213 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 214 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 215 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 216 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 217 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 218 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 219 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 220 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 221 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 222 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 223 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 224 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 225 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 226 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 227 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 228 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 229 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 230 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 231 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 232 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 233 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 234 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 235 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 236 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 237 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 238 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 239 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 240 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 241 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 242 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 243 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 244 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 245 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 246 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 247 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466702_198103 | 3300042635 | Bacteria | 2774 |
| 2 | Ga0466704_042237 | 3300042643 | Bacteria | 1429 |
| 3 | Ga0466709_049894 | 3300042648 | Unclassified | 53806 |
| 4 | Ga0466724_31439 | 3300042649 | Bacteria | 9380 |
| 5 | Ga0466727_080583 | 3300042655 | Bacteria | 8696 |
| 6 | Ga0466706_074539 | 3300042599 | Bacteria | 137679 |
| 7 | Ga0123356_10006381 | 3300010049 | Bacteria | 11883 |
| 8 | Ga0466710_209366 | 3300042613 | Bacteria | 5797 |
| 9 | Ga0466657_113751 | 3300042582 | Bacteria | 130632 |
| 10 | Ga0466699_116488 | 3300042597 | Bacteria | 2745 |
| 11 | Ga0466735_078916 | 3300042624 | Bacteria | 6122 |
| 12 | Ga0466706_087956 | 3300042599 | Bacteria | 6007 |
| 13 | Ga0466720_017237 | 3300042607 | Bacteria | 16171 |
| 14 | Ga0123353_10000040 | 3300010167 | Bacteria | 139340 |
| 15 | Ga0466711_390078 | 3300042615 | Bacteria | 32121 |
| 16 | Ga0466715_409945 | 3300042616 | Unclassified | 67330 |
| 17 | Ga0160455_100022 | 3300012837 | Bacteria | 376035 |
| 18 | Ga0160472_100173 | 3300012839 | Unclassified | 86925 |
| 19 | Ga0466696_385317 | 3300042596 | Bacteria | 6250 |
| 20 | JGI24700J35501_10930601 | 3300002508 | Bacteria | 16421 |
| 21 | JGI24700J35501_10930603 | 3300002508 | Bacteria | 16440 |
| 22 | Ga0466705_180755 | 3300042612 | Unclassified | 2499 |
| 23 | Ga0562376_0081 | 3300056857 | Bacteria | 226138 |
| 24 | Ga0466709_339590 | 3300042648 | Bacteria | 5218 |
| 25 | Ga0466724_25733 | 3300042649 | Bacteria | 9630 |
| 26 | Ga0466706_272622 | 3300042599 | Unclassified | 7974 |
| 27 | Ga0123356_10004192 | 3300010049 | Bacteria | 14942 |
| 28 | Ga0123356_10458155 | 3300010049 | Bacteria | 1424 |
| 29 | Ga0466705_436923 | 3300042612 | Bacteria | 7832 |
| 30 | Ga0466712_232413 | 3300042614 | Bacteria | 21480 |
| 31 | Ga0466715_310632 | 3300042616 | Bacteria | 3353 |
| 32 | Ga0466718_147373 | 3300042617 | Bacteria | 11031 |
| 33 | Ga0466726_083459 | 3300042619 | Bacteria | 2394 |
| 34 | Ga0466726_363045 | 3300042619 | Unclassified | 6586 |
| 35 | Ga0466729_168231 | 3300042621 | Bacteria | 9378 |
| 36 | Ga0160469_100210 | 3300012824 | Bacteria | 50416 |
| 37 | Ga0160430_108566 | 3300012852 | Bacteria | 1921 |
| 38 | Ga0466691_104899 | 3300042593 | Bacteria | 9924 |
| 39 | 2227080779 | 2225789004 | Bacteria | 173520 |
| 40 | Ga0123357_10000609 | 3300009784 | Bacteria | 35481 |
| 41 | Ga0466703_384890 | 3300042636 | Bacteria | 3182 |
| 42 | Ga0466725_130312 | 3300042654 | Bacteria | 15939 |
| 43 | Ga0466706_004221 | 3300042599 | Bacteria | 8739 |
| 44 | Ga0466722_055790 | 3300042609 | Bacteria | 11661 |
| 45 | Ga0123356_10125115 | 3300010049 | Unclassified | 2508 |
| 46 | Ga0160454_100487 | 3300012798 | Bacteria | 14283 |
| 47 | Ga0160471_102359 | 3300012812 | Bacteria | 3163 |
| 48 | Ga0466718_157466 | 3300042617 | Bacteria | 5577 |
| 49 | Ga0466726_024792 | 3300042619 | Bacteria | 26336 |
| 50 | Ga0466729_152338 | 3300042621 | Bacteria | 104951 |
| 51 | Ga0160447_100927 | 3300012849 | Bacteria | 12313 |
| 52 | Ga0466692_145287 | 3300042591 | Bacteria | 39430 |
| 53 | Ga0466701_015229 | 3300042598 | Bacteria | 10106 |
| 54 | Ga0072940_1080275 | 3300005200 | Bacteria | 4037 |
| 55 | Ga0123357_10000734 | 3300009784 | Bacteria | 33022 |
| 56 | Ga0466727_157224 | 3300042655 | Bacteria | 8350 |
| 57 | Ga0466717_290119 | 3300042604 | Bacteria | 2833 |
| 58 | Ga0466716_183516 | 3300042605 | Bacteria | 11086 |
| 59 | Ga0466722_164655 | 3300042609 | Bacteria | 24827 |
| 60 | Ga0466722_220136 | 3300042609 | Bacteria | 5174 |
| 61 | Ga0123355_10146644 | 3300009826 | Unclassified | 3597 |
| 62 | Ga0466710_254735 | 3300042613 | Bacteria | 2127 |
| 63 | Ga0466711_273053 | 3300042615 | Bacteria | 15842 |
| 64 | Ga0466723_325720 | 3300042618 | Bacteria | 2670 |
| 65 | Ga0160448_100320 | 3300012854 | Bacteria | 17927 |
| 66 | Ga0264413_130089 | 3300024493 | Bacteria | 2926 |
| 67 | Ga0466701_004108 | 3300042598 | Bacteria | 13088 |
| 68 | Ga0068305_10662626 | 3300005083 | Bacteria | 1447 |
| 69 | Ga0072941_1123023 | 3300005201 | Bacteria | 3429 |
| 70 | Ga0466735_144028 | 3300042624 | Bacteria | 1728 |
| 71 | Ga0466706_032431 | 3300042599 | Bacteria | 50635 |
| 72 | Ga0466706_200541 | 3300042599 | Bacteria | 48383 |
| 73 | Ga0466706_229988 | 3300042599 | Bacteria | 8411 |
| 74 | Ga0466706_283701 | 3300042599 | Bacteria | 11721 |
| 75 | Ga0466700_421632 | 3300042600 | Bacteria | 2556 |
| 76 | Ga0466707_006107 | 3300042601 | Bacteria | 44573 |
| 77 | Ga0123353_10000443 | 3300010167 | Bacteria | 51439 |
| 78 | Ga0160465_101080 | 3300012803 | Bacteria | 8768 |
| 79 | Ga0160466_100063 | 3300012809 | Bacteria | 125464 |
| 80 | Ga0160471_100192 | 3300012812 | Bacteria | 22155 |
| 81 | Ga0466710_217703 | 3300042613 | Bacteria | 3373 |
| 82 | Ga0160440_100092 | 3300012815 | Unclassified | 101876 |
| 83 | Ga0160433_100097 | 3300012846 | Bacteria | 88061 |
| 84 | Ga0160448_105441 | 3300012854 | Bacteria | 3332 |
| 85 | Ga0265387_1000025 | 3300024582 | Bacteria | 63430 |
| 86 | Ga0466695_049622 | 3300042595 | Bacteria | 26917 |
| 87 | Ga0466699_101882 | 3300042597 | Bacteria | 6010 |
| 88 | Ga0466699_152342 | 3300042597 | Unclassified | 1727 |
| 89 | JGI24698J34947_10059177 | 3300002449 | Bacteria | 1895 |
| 90 | Ga0466697_120553 | 3300042611 | Bacteria | 2779 |
| 91 | Ga0562378_0459 | 3300056814 | Bacteria | 69701 |
| 92 | Ga0466734_082283 | 3300042623 | Bacteria | 7876 |
| 93 | Ga0466704_363902 | 3300042643 | Bacteria | 140929 |
| 94 | Ga0466709_283453 | 3300042648 | Bacteria | 4003 |
| 95 | Ga0466724_32630 | 3300042649 | Bacteria | 13538 |
| 96 | Ga0466706_059862 | 3300042599 | Bacteria | 15934 |
| 97 | Ga0466706_169919 | 3300042599 | Bacteria | 11913 |
| 98 | Ga0466713_054975 | 3300042602 | Unclassified | 3152 |
| 99 | Ga0466722_008722 | 3300042609 | Bacteria | 4421 |
| 100 | Ga0123356_10018642 | 3300010049 | Bacteria | 6586 |
| 101 | Ga0466710_317641 | 3300042613 | Bacteria | 36750 |
| 102 | Ga0466718_074789 | 3300042617 | Bacteria | 15598 |
| 103 | Ga0466723_070255 | 3300042618 | Bacteria | 28764 |
| 104 | Ga0466726_425806 | 3300042619 | Bacteria | 8348 |
| 105 | Ga0466728_370042 | 3300042620 | Bacteria | 4210 |
| 106 | Ga0466657_219053 | 3300042582 | Bacteria | 26717 |
| 107 | Ga0466691_044915 | 3300042593 | Bacteria | 21854 |
| 108 | Ga0466694_372464 | 3300042594 | Bacteria | 1319 |
| 109 | IMNBL1DRAFT_c0018833 | 3300000062 | Bacteria | 2854 |
| 110 | AustNasuHG_c1008698 | 3300000089 | Bacteria | 3593 |
| 111 | Ga0466705_383529 | 3300042612 | Bacteria | 10943 |
| 112 | Ga0562374_1417 | 3300057007 | Unclassified | 28023 |
| 113 | Ga0466725_187893 | 3300042654 | Bacteria | 24541 |
| 114 | Ga0466706_004763 | 3300042599 | Unclassified | 33253 |
| 115 | Ga0466706_140683 | 3300042599 | Bacteria | 7002 |
| 116 | Ga0466717_290149 | 3300042604 | Unclassified | 1786 |
| 117 | Ga0123355_10156936 | 3300009826 | Unclassified | 3440 |
| 118 | Ga0123356_10156848 | 3300010049 | Unclassified | 2268 |
| 119 | Ga0160470_100050 | 3300012813 | Bacteria | 172769 |
| 120 | Ga0466726_278972 | 3300042619 | Bacteria | 29992 |
| 121 | Ga0160470_101171 | 3300012813 | Bacteria | 6882 |
| 122 | Ga0160467_100219 | 3300012829 | Bacteria | 73493 |
| 123 | Ga0160443_100020 | 3300012848 | Bacteria | 410950 |
| 124 | Ga0160430_102382 | 3300012852 | Bacteria | 5997 |
| 125 | Ga0466690_080050 | 3300042590 | Bacteria | 2647 |
| 126 | Ga0466696_010114 | 3300042596 | Bacteria | 17230 |
| 127 | Ga0466699_422540 | 3300042597 | Bacteria | 6738 |
| 128 | IMNBL1DRAFT_c0009347 | 3300000062 | Bacteria | 4848 |
| 129 | Ga0068305_10004492 | 3300005083 | Bacteria | 39529 |
| 130 | Ga0072940_1109148 | 3300005200 | Bacteria | 6837 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_390078 | Ga0466711_390078_14044_15207 | 320 |
| 2 | 3300042599 | Ga0466706_272622 | Ga0466706_272622_3321_4523 | 326 |
| 3 | 3300042599 | Ga0466706_140683 | Ga0466706_140683_5210_6328 | 333 |
| 4 | 3300042599 | Ga0466706_032431 | Ga0466706_032431_28263_29465 | 337 |
| 5 | 3300042599 | Ga0466706_200541 | Ga0466706_200541_27047_28249 | 337 |
| 6 | 3300042599 | Ga0466706_229988 | Ga0466706_229988_1637_2839 | 339 |
| 7 | 3300042599 | Ga0466706_087956 | Ga0466706_087956_2664_3878 | 340 |
| 8 | 3300024493 | Ga0264413_130089 | Ga0264413_1300893 | 344 |
| 9 | 3300002508 | JGI24700J35501_10930601 | JGI24700J35501_109306015 | 346 |
| 10 | 3300010167 | Ga0123353_10000443 | Ga0123353_100004438 | 347 |
| 11 | 3300010049 | Ga0123356_10156848 | Ga0123356_101568482 | 353 |
| 12 | 3300010049 | Ga0123356_10125115 | Ga0123356_101251151 | 354 |
| 13 | 3300042599 | Ga0466706_059862 | Ga0466706_059862_12777_13952 | 355 |
| 14 | 3300042619 | Ga0466726_363045 | Ga0466726_363045_2739_3938 | 357 |
| 15 | 3300010049 | Ga0123356_10006381 | Ga0123356_100063815 | 360 |
| 16 | 3300042599 | Ga0466706_004763 | Ga0466706_004763_29550_30752 | 363 |
| 17 | 3300042599 | Ga0466706_004221 | Ga0466706_004221_1482_2684 | 364 |
| 18 | 3300042599 | Ga0466706_074539 | Ga0466706_074539_43536_44726 | 364 |
| 19 | 3300042618 | Ga0466723_325720 | Ga0466723_325720_1330_2523 | 367 |
| 20 | 3300042604 | Ga0466717_290149 | Ga0466717_290149_448_1671 | 369 |
| 21 | 3300042655 | Ga0466727_080583 | Ga0466727_080583_3796_4995 | 372 |
| 22 | 3300012852 | Ga0160430_102382 | Ga0160430_1023822 | 373 |
| 23 | 3300002508 | JGI24700J35501_10930603 | JGI24700J35501_109306034 | 375 |
| 24 | 3300042597 | Ga0466699_152342 | Ga0466699_152342_125_1303 | 375 |
| 25 | iso_pr_bacteria | 2585428085 | 2587835849 | 378 |
| 26 | 2225789004 | 2227080779 | 2227452391 | 379 |
| 27 | 3300042595 | Ga0466695_049622 | Ga0466695_049622_2213_3391 | 382 |
| 28 | 3300000089 | AustNasuHG_c1008698 | AustNasuHG_10086984 | 383 |
| 29 | iso_pr_bacteria | 2788499854 | 2788759877 | 383 |
| 30 | iso_pr_bacteria | 2940352027 | 2940352777 | 383 |
| 31 | iso_pr_bacteria | 2940354458 | 2940355208 | 383 |
| 32 | iso_pr_bacteria | 2940356891 | 2940357642 | 383 |
| 33 | iso_pr_bacteria | 2940359323 | 2940360183 | 383 |
| 34 | iso_pr_bacteria | 2940361758 | 2940362617 | 383 |
| 35 | iso_pr_bacteria | 2940364193 | 2940365061 | 383 |
| 36 | iso_pr_bacteria | 2940366561 | 2940367490 | 383 |
| 37 | iso_pr_bacteria | 2940368928 | 2940369768 | 383 |
| 38 | 3300042597 | Ga0466699_422540 | Ga0466699_422540_4502_5680 | 384 |
| 39 | 3300042616 | Ga0466715_409945 | Ga0466715_409945_11072_12346 | 384 |
| 40 | 3300042597 | Ga0466699_101882 | Ga0466699_101882_1457_2635 | 386 |
| 41 | 3300042601 | Ga0466707_006107 | Ga0466707_006107_32136_33410 | 386 |
| 42 | 3300042648 | Ga0466709_049894 | Ga0466709_049894_11565_12839 | 386 |
| 43 | 3300000062 | IMNBL1DRAFT_c0009347 | IMNBL1DRAFT_00093474 | 387 |
| 44 | 3300005083 | Ga0068305_10004492 | Ga0068305_100044929 | 387 |
| 45 | 3300042602 | Ga0466713_054975 | Ga0466713_054975_1467_2741 | 387 |
| 46 | 3300042617 | Ga0466718_157466 | Ga0466718_157466_1276_2493 | 387 |
| 47 | 3300042612 | Ga0466705_436923 | Ga0466705_436923_1261_2532 | 389 |
| 48 | 3300012812 | Ga0160471_100192 | Ga0160471_10019214 | 390 |
| 49 | 3300012813 | Ga0160470_101171 | Ga0160470_1011714 | 390 |
| 50 | iso_pr_bacteria | 2940236825 | 2940237768 | 390 |
| 51 | iso_pr_bacteria | 2940339133 | 2940340177 | 390 |
| 52 | iso_pr_bacteria | 2940341480 | 2940342667 | 390 |
| 53 | iso_pr_bacteria | 2940343849 | 2940344973 | 390 |
| 54 | 3300000062 | IMNBL1DRAFT_c0018833 | IMNBL1DRAFT_00188333 | 391 |
| 55 | 3300042594 | Ga0466694_372464 | Ga0466694_372464_106_1284 | 392 |
| 56 | 3300005200 | Ga0072940_1109148 | Ga0072940_11091485 | 393 |
| 57 | 3300012837 | Ga0160455_100022 | Ga0160455_100022146 | 393 |
| 58 | 3300042635 | Ga0466702_198103 | Ga0466702_198103_178_1362 | 394 |
| 59 | 3300009784 | Ga0123357_10000609 | Ga0123357_100006095 | 395 |
| 60 | 3300010049 | Ga0123356_10458155 | Ga0123356_104581551 | 395 |
| 61 | 3300042648 | Ga0466709_339590 | Ga0466709_339590_49_1236 | 395 |
| 62 | 3300012854 | Ga0160448_105441 | Ga0160448_1054412 | 396 |
| 63 | 3300042599 | Ga0466706_169919 | Ga0466706_169919_3390_4691 | 396 |
| 64 | 3300005200 | Ga0072940_1080275 | Ga0072940_10802753 | 397 |
| 65 | 3300009826 | Ga0123355_10146644 | Ga0123355_101466442 | 397 |
| 66 | 3300009826 | Ga0123355_10156936 | Ga0123355_101569361 | 397 |
| 67 | 3300010049 | Ga0123356_10018642 | Ga0123356_100186426 | 398 |
| 68 | 3300042596 | Ga0466696_010114 | Ga0466696_010114_5776_6972 | 398 |
| 69 | 3300042605 | Ga0466716_183516 | Ga0466716_183516_1640_2836 | 398 |
| 70 | 3300042616 | Ga0466715_310632 | Ga0466715_310632_1334_2530 | 398 |
| 71 | 3300010049 | Ga0123356_10004192 | Ga0123356_100041925 | 399 |
| 72 | 3300012798 | Ga0160454_100487 | Ga0160454_1004873 | 399 |
| 73 | 3300042619 | Ga0466726_278972 | Ga0466726_278972_18963_20162 | 399 |
| 74 | 3300042619 | Ga0466726_425806 | Ga0466726_425806_5201_6400 | 399 |
| 75 | 3300042607 | Ga0466720_017237 | Ga0466720_017237_4761_6026 | 400 |
| 76 | 3300012852 | Ga0160430_108566 | Ga0160430_1085662 | 401 |
| 77 | 3300042598 | Ga0466701_015229 | Ga0466701_015229_7924_9240 | 402 |
| 78 | iso_pr_bacteria | 2820418027 | 2820418671 | 402 |
| 79 | 3300042621 | Ga0466729_152338 | Ga0466729_152338_52311_53564 | 403 |
| 80 | iso_pr_bacteria | 2511231129 | 2511733529 | 404 |
| 81 | iso_pr_bacteria | 2531839005 | 2531869301 | 404 |
| 82 | iso_pr_bacteria | 2551306507 | 2553348262 | 404 |
| 83 | iso_pr_bacteria | 2565956518 | 2566025367 | 404 |
| 84 | iso_pr_bacteria | 2571042430 | 2572514416 | 404 |
| 85 | iso_pr_bacteria | 2571042554 | 2572927825 | 404 |
| 86 | iso_pr_bacteria | 2648501158 | 2648748306 | 404 |
| 87 | iso_pr_bacteria | 2654587515 | 2654660811 | 404 |
| 88 | iso_pr_bacteria | 2663763317 | 2666539076 | 404 |
| 89 | iso_pr_bacteria | 2667527830 | 2669649491 | 404 |
| 90 | iso_pr_bacteria | 2667527887 | 2669891592 | 404 |
| 91 | iso_pr_bacteria | 2684622551 | 2684820515 | 404 |
| 92 | iso_pr_bacteria | 2693429575 | 2693741666 | 404 |
| 93 | iso_pr_bacteria | 2700989396 | 2702439357 | 404 |
| 94 | iso_pr_bacteria | 2731957638 | 2732531729 | 404 |
| 95 | iso_pr_bacteria | 2785510762 | 2785801847 | 404 |
| 96 | iso_pr_bacteria | 2791355471 | 2794373621 | 404 |
| 97 | iso_pr_bacteria | 2850895757 | 2850900000 | 404 |
| 98 | iso_pr_bacteria | 2860776474 | 2860780026 | 404 |
| 99 | iso_pr_bacteria | 2872471378 | 2872476440 | 404 |
| 100 | iso_pr_bacteria | 2875320051 | 2875324951 | 404 |
| 101 | iso_pr_bacteria | 2877638525 | 2877642972 | 404 |
| 102 | iso_pr_bacteria | 2877647439 | 2877652050 | 404 |
| 103 | iso_pr_bacteria | 2880115952 | 2880120410 | 404 |
| 104 | iso_pr_bacteria | 2908136803 | 2908141239 | 404 |
| 105 | iso_pr_bacteria | 2912570088 | 2912574125 | 404 |
| 106 | iso_pr_bacteria | 2989793055 | 2989794820 | 404 |
| 107 | iso_pr_bacteria | 2997380424 | 2997385267 | 404 |
| 108 | iso_pr_bacteria | 3006225627 | 3006229061 | 404 |
| 109 | iso_pr_bacteria | 8008122225 | 8008124818 | 404 |
| 110 | iso_pr_bacteria | 8022096067 | 8022097274 | 404 |
| 111 | iso_pr_bacteria | 8042061949 | 8042065148 | 404 |
| 112 | iso_pr_bacteria | 8051461712 | 8051463654 | 404 |
| 113 | iso_pr_bacteria | 8051534459 | 8051536646 | 404 |
| 114 | iso_pr_bacteria | 8051551332 | 8051556016 | 404 |
| 115 | iso_pr_bacteria | 8060845732 | 8060846091 | 404 |
| 116 | 3300012829 | Ga0160467_100219 | Ga0160467_10021914 | 405 |
| 117 | 3300042599 | Ga0466706_283701 | Ga0466706_283701_4101_5414 | 405 |
| 118 | 3300042604 | Ga0466717_290119 | Ga0466717_290119_975_2192 | 405 |
| 119 | iso_pr_bacteria | 2600255074 | 2600846920 | 405 |
| 120 | iso_pr_bacteria | 2711768158 | 2712479426 | 405 |
| 121 | iso_pr_bacteria | 2820946191 | 2820946556 | 405 |
| 122 | iso_pr_bacteria | 3006242587 | 3006244069 | 405 |
| 123 | iso_pr_bacteria | 8022439116 | 8022439916 | 405 |
| 124 | iso_pr_bacteria | 8033364368 | 8033365765 | 405 |
| 125 | iso_pr_bacteria | 8033368880 | 8033370957 | 405 |
| 126 | iso_pr_bacteria | 2791355473 | 2794385965 | 406 |
| 127 | 3300012846 | Ga0160433_100097 | Ga0160433_10009793 | 407 |
| 128 | 3300012809 | Ga0160466_100063 | Ga0160466_100063113 | 409 |
| 129 | 3300042600 | Ga0466700_421632 | Ga0466700_421632_491_1813 | 410 |
| 130 | 3300042612 | Ga0466705_180755 | Ga0466705_180755_1107_2339 | 410 |
| 131 | 3300042617 | Ga0466718_074789 | Ga0466718_074789_4472_5734 | 410 |
| 132 | 3300042636 | Ga0466703_384890 | Ga0466703_384890_10_1242 | 410 |
| 133 | 3300042655 | Ga0466727_157224 | Ga0466727_157224_2606_3838 | 410 |
| 134 | 3300010167 | Ga0123353_10000040 | Ga0123353_1000004051 | 411 |
| 135 | 3300042590 | Ga0466690_080050 | Ga0466690_080050_482_1717 | 411 |
| 136 | 3300042593 | Ga0466691_104899 | Ga0466691_104899_1615_2850 | 411 |
| 137 | 3300042618 | Ga0466723_070255 | Ga0466723_070255_27328_28563 | 411 |
| 138 | 3300042620 | Ga0466728_370042 | Ga0466728_370042_1369_2604 | 411 |
| 139 | 3300042593 | Ga0466691_044915 | Ga0466691_044915_569_1807 | 412 |
| 140 | 3300042617 | Ga0466718_147373 | Ga0466718_147373_8901_10229 | 413 |
| 141 | iso_pr_bacteria | 637000113 | 640742736 | 413 |
| 142 | 3300005201 | Ga0072941_1123023 | Ga0072941_11230232 | 415 |
| 143 | 3300042598 | Ga0466701_004108 | Ga0466701_004108_858_2180 | 415 |
| 144 | 3300012824 | Ga0160469_100210 | Ga0160469_1002106 | 417 |
| 145 | iso_pr_bacteria | 2912636047 | 2912640345 | 417 |
| 146 | iso_pr_bacteria | 8022116796 | 8022119215 | 417 |
| 147 | iso_pr_bacteria | 8022345672 | 8022347913 | 417 |
| 148 | 3300042597 | Ga0466699_116488 | Ga0466699_116488_389_1651 | 420 |
| 149 | iso_pr_bacteria | 2556921669 | 2558279847 | 420 |
| 150 | iso_pr_bacteria | 2820115951 | 2820117726 | 420 |
| 151 | iso_pr_bacteria | 2820947865 | 2820948972 | 420 |
| 152 | iso_pr_bacteria | 2864976888 | 2864977860 | 420 |
| 153 | 3300012813 | Ga0160470_100050 | Ga0160470_10005023 | 421 |
| 154 | 3300012849 | Ga0160447_100927 | Ga0160447_1009279 | 421 |
| 155 | 3300012839 | Ga0160472_100173 | Ga0160472_10017376 | 422 |
| 156 | 3300024582 | Ga0265387_1000025 | Ga0265387_100002553 | 422 |
| 157 | 3300042596 | Ga0466696_385317 | Ga0466696_385317_2949_4217 | 422 |
| 158 | 3300042609 | Ga0466722_164655 | Ga0466722_164655_19759_21027 | 422 |
| 159 | iso_pr_bacteria | 2597489944 | 2598060590 | 422 |
| 160 | iso_pr_bacteria | 2772190782 | 2772999693 | 422 |
| 161 | iso_pr_bacteria | 2806310685 | 2807226967 | 422 |
| 162 | iso_pr_bacteria | 2864993140 | 2864993680 | 422 |
| 163 | iso_pr_bacteria | 2873468275 | 2873468815 | 422 |
| 164 | 3300042609 | Ga0466722_008722 | Ga0466722_008722_302_1573 | 423 |
| 165 | 3300042609 | Ga0466722_220136 | Ga0466722_220136_1618_2889 | 423 |
| 166 | 3300042612 | Ga0466705_383529 | Ga0466705_383529_7257_8528 | 423 |
| 167 | 3300042614 | Ga0466712_232413 | Ga0466712_232413_15933_17204 | 423 |
| 168 | 3300042615 | Ga0466711_273053 | Ga0466711_273053_11792_13063 | 423 |
| 169 | 3300042619 | Ga0466726_083459 | Ga0466726_083459_314_1585 | 423 |
| 170 | 3300042621 | Ga0466729_168231 | Ga0466729_168231_7237_8508 | 423 |
| 171 | 3300042624 | Ga0466735_078916 | Ga0466735_078916_4445_5716 | 423 |
| 172 | 3300042624 | Ga0466735_144028 | Ga0466735_144028_78_1349 | 423 |
| 173 | 3300042643 | Ga0466704_363902 | Ga0466704_363902_32491_33762 | 423 |
| 174 | 3300042648 | Ga0466709_283453 | Ga0466709_283453_489_1760 | 423 |
| 175 | iso_pr_bacteria | 2506210010 | 2506291012 | 423 |
| 176 | iso_pr_bacteria | 2506210015 | 2506302325 | 423 |
| 177 | iso_pr_bacteria | 2871564055 | 2871565442 | 423 |
| 178 | iso_pr_bacteria | 2871595141 | 2871596520 | 423 |
| 179 | iso_pr_bacteria | 2874203443 | 2874204822 | 423 |
| 180 | iso_pr_bacteria | 2874209778 | 2874211542 | 423 |
| 181 | iso_pr_bacteria | 2889908211 | 2889910917 | 423 |
| 182 | iso_pr_bacteria | 8025701579 | 8025702373 | 423 |
| 183 | iso_pr_bacteria | 8025728939 | 8025733856 | 423 |
| 184 | iso_pr_bacteria | 8102174626 | 8102179543 | 423 |
| 185 | iso_pr_bacteria | 8102201977 | 8102202771 | 423 |
| 186 | 3300002449 | JGI24698J34947_10059177 | JGI24698J34947_100591771 | 424 |
| 187 | 3300005083 | Ga0068305_10662626 | Ga0068305_106626261 | 424 |
| 188 | 3300012812 | Ga0160471_102359 | Ga0160471_1023593 | 424 |
| 189 | 3300012854 | Ga0160448_100320 | Ga0160448_1003205 | 424 |
| 190 | iso_pr_bacteria | 2820123897 | 2820126866 | 424 |
| 191 | iso_pr_bacteria | 2820309449 | 2820310686 | 424 |
| 192 | iso_pr_bacteria | 8023724303 | 8023726629 | 424 |
| 193 | iso_pr_bacteria | 8023747282 | 8023748688 | 424 |
| 194 | iso_pr_bacteria | 8023752828 | 8023752961 | 424 |
| 195 | iso_pr_bacteria | 8023757577 | 8023759903 | 424 |
| 196 | iso_pr_bacteria | 8023764196 | 8023768095 | 424 |
| 197 | iso_pr_bacteria | 8024001094 | 8024004792 | 424 |
| 198 | iso_pr_bacteria | 8024014383 | 8024017845 | 424 |
| 199 | iso_pr_bacteria | 8024019580 | 8024023058 | 424 |
| 200 | iso_pr_bacteria | 8024025509 | 8024029006 | 424 |
| 201 | iso_pr_bacteria | 8024037630 | 8024041183 | 424 |
| 202 | iso_pr_bacteria | 8024044713 | 8024047998 | 424 |
| 203 | iso_pr_bacteria | 8025650824 | 8025657039 | 424 |
| 204 | iso_pr_bacteria | 8025658853 | 8025664698 | 424 |
| 205 | iso_pr_bacteria | 8025666332 | 8025670544 | 424 |
| 206 | iso_pr_bacteria | 8025671076 | 8025677248 | 424 |
| 207 | iso_pr_bacteria | 8025678175 | 8025684342 | 424 |
| 208 | iso_pr_bacteria | 8025685901 | 8025693076 | 424 |
| 209 | iso_pr_bacteria | 8025694439 | 8025700482 | 424 |
| 210 | iso_pr_bacteria | 8025708040 | 8025713957 | 424 |
| 211 | iso_pr_bacteria | 8025716094 | 8025721346 | 424 |
| 212 | iso_pr_bacteria | 8025723035 | 8025727922 | 424 |
| 213 | iso_pr_bacteria | 8025735396 | 8025738896 | 424 |
| 214 | iso_pr_bacteria | 8025740903 | 8025746663 | 424 |
| 215 | iso_pr_bacteria | 8025747911 | 8025753725 | 424 |
| 216 | iso_pr_bacteria | 8025756023 | 8025761839 | 424 |
| 217 | iso_pr_bacteria | 8069748016 | 8069753288 | 424 |
| 218 | iso_pr_bacteria | 8069755105 | 8069760919 | 424 |
| 219 | iso_pr_bacteria | 8069763219 | 8069768979 | 424 |
| 220 | iso_pr_bacteria | 8069770227 | 8069771633 | 424 |
| 221 | iso_pr_bacteria | 8069775773 | 8069775906 | 424 |
| 222 | iso_pr_bacteria | 8078130113 | 8078133652 | 424 |
| 223 | iso_pr_bacteria | 8101951471 | 8101955053 | 424 |
| 224 | iso_pr_bacteria | 8101960468 | 8101964009 | 424 |
| 225 | iso_pr_bacteria | 8101967387 | 8101970988 | 424 |
| 226 | iso_pr_bacteria | 8101974301 | 8101977783 | 424 |
| 227 | iso_pr_bacteria | 8101981714 | 8101985049 | 424 |
| 228 | iso_pr_bacteria | 8101988189 | 8101991596 | 424 |
| 229 | iso_pr_bacteria | 8101994502 | 8101998065 | 424 |
| 230 | iso_pr_bacteria | 8102001125 | 8102004403 | 424 |
| 231 | iso_pr_bacteria | 8102007614 | 8102011160 | 424 |
| 232 | iso_pr_bacteria | 8102014801 | 8102018431 | 424 |
| 233 | iso_pr_bacteria | 8102020860 | 8102024078 | 424 |
| 234 | iso_pr_bacteria | 8102026984 | 8102030424 | 424 |
| 235 | iso_pr_bacteria | 8102033761 | 8102037627 | 424 |
| 236 | iso_pr_bacteria | 8102041249 | 8102044539 | 424 |
| 237 | iso_pr_bacteria | 8102047609 | 8102051126 | 424 |
| 238 | iso_pr_bacteria | 8102054868 | 8102058133 | 424 |
| 239 | iso_pr_bacteria | 8102060671 | 8102064260 | 424 |
| 240 | iso_pr_bacteria | 8102067727 | 8102071236 | 424 |
| 241 | iso_pr_bacteria | 8102074813 | 8102078374 | 424 |
| 242 | iso_pr_bacteria | 8102081745 | 8102085214 | 424 |
| 243 | iso_pr_bacteria | 8102087471 | 8102090701 | 424 |
| 244 | iso_pr_bacteria | 8102094248 | 8102097759 | 424 |
| 245 | iso_pr_bacteria | 8102102351 | 8102105798 | 424 |
| 246 | iso_pr_bacteria | 8102109360 | 8102112817 | 424 |
| 247 | iso_pr_bacteria | 8102117041 | 8102120534 | 424 |
| 248 | iso_pr_bacteria | 8102124461 | 8102127943 | 424 |
| 249 | iso_pr_bacteria | 8102131453 | 8102132604 | 424 |
| 250 | iso_pr_bacteria | 8102138357 | 8102141801 | 424 |
| 251 | iso_pr_bacteria | 8102145433 | 8102147759 | 424 |
| 252 | iso_pr_bacteria | 8102152052 | 8102155951 | 424 |
| 253 | iso_pr_bacteria | 8102161003 | 8102163825 | 424 |
| 254 | iso_pr_bacteria | 8102169119 | 8102172619 | 424 |
| 255 | iso_pr_bacteria | 8102181083 | 8102185970 | 424 |
| 256 | iso_pr_bacteria | 8102186987 | 8102192237 | 424 |
| 257 | iso_pr_bacteria | 8102193924 | 8102199839 | 424 |
| 258 | iso_pr_bacteria | 8102208438 | 8102214653 | 424 |
| 259 | iso_pr_bacteria | 8102216467 | 8102222510 | 424 |
| 260 | iso_pr_bacteria | 8102223607 | 8102229779 | 424 |
| 261 | iso_pr_bacteria | 8102230706 | 8102237881 | 424 |
| 262 | iso_pr_bacteria | 8102239244 | 8102245409 | 424 |
| 263 | iso_pr_bacteria | 8102246966 | 8102251178 | 424 |
| 264 | iso_pr_bacteria | 8102251710 | 8102257555 | 424 |
| 265 | iso_pr_bacteria | 8102264549 | 8102267986 | 424 |
| 266 | iso_pr_bacteria | 8102271933 | 8102275375 | 424 |
| 267 | iso_pr_bacteria | 8102279326 | 8102282956 | 424 |
| 268 | iso_pr_bacteria | 8102286609 | 8102290163 | 424 |
| 269 | iso_pr_bacteria | 8102312426 | 8102315720 | 424 |
| 270 | 3300009784 | Ga0123357_10000734 | Ga0123357_1000073413 | 425 |
| 271 | 3300012815 | Ga0160440_100092 | Ga0160440_10009282 | 425 |
| 272 | 3300042619 | Ga0466726_024792 | Ga0466726_024792_9642_10919 | 425 |
| 273 | iso_pr_bacteria | 2820298281 | 2820300343 | 425 |
| 274 | iso_pr_bacteria | 640963010 | 641027910 | 425 |
| 275 | iso_pr_bacteria | 2864808494 | 2864810216 | 426 |
| 276 | iso_pr_bacteria | 2864812326 | 2864814048 | 426 |
| 277 | iso_pr_bacteria | 2820492969 | 2820495133 | 428 |
| 278 | 3300042582 | Ga0466657_219053 | Ga0466657_219053_11720_13009 | 429 |
| 279 | 3300042582 | Ga0466657_113751 | Ga0466657_113751_71106_72413 | 435 |
| 280 | 3300042613 | Ga0466710_317641 | Ga0466710_317641_19673_20980 | 435 |
| 281 | 3300042654 | Ga0466725_130312 | Ga0466725_130312_4369_5676 | 435 |
| 282 | 3300042649 | Ga0466724_25733 | Ga0466724_25733_5984_7294 | 436 |
| 283 | 3300042649 | Ga0466724_32630 | Ga0466724_32630_5824_7134 | 436 |
| 284 | 3300056857 | Ga0562376_0081 | Ga0562376_0081_90146_91456 | 436 |
| 285 | 3300057007 | Ga0562374_1417 | Ga0562374_1417_21913_23223 | 436 |
| 286 | iso_pr_bacteria | 2841260384 | 2841262712 | 436 |
| 287 | iso_pr_bacteria | 8101676404 | 8101678700 | 436 |
| 288 | iso_pr_bacteria | 8101680043 | 8101683521 | 436 |
| 289 | iso_pr_bacteria | 8101683685 | 8101684292 | 436 |
| 290 | iso_pr_bacteria | 2791355473 | 2794383332 | 437 |
| 291 | iso_pr_bacteria | 2820152154 | 2820154477 | 437 |
| 292 | 3300042623 | Ga0466734_082283 | Ga0466734_082283_4504_5820 | 438 |
| 293 | 3300042654 | Ga0466725_187893 | Ga0466725_187893_8285_9601 | 438 |
| 294 | 3300042613 | Ga0466710_209366 | Ga0466710_209366_680_1999 | 439 |
| 295 | 3300042613 | Ga0466710_217703 | Ga0466710_217703_673_1992 | 439 |
| 296 | 3300042613 | Ga0466710_254735 | Ga0466710_254735_589_1908 | 439 |
| 297 | 3300056814 | Ga0562378_0459 | Ga0562378_0459_61311_62630 | 439 |
| 298 | iso_pr_bacteria | 2820084079 | 2820084092 | 439 |
| 299 | iso_pr_bacteria | 2820086750 | 2820086800 | 439 |
| 300 | 3300042649 | Ga0466724_31439 | Ga0466724_31439_3853_5175 | 440 |
| 301 | 3300042611 | Ga0466697_120553 | Ga0466697_120553_135_1460 | 441 |
| 302 | iso_pr_bacteria | 2820161938 | 2820163065 | 441 |
| 303 | iso_pr_bacteria | 2820164216 | 2820164509 | 441 |
| 304 | iso_pr_bacteria | 2756170277 | 2756797662 | 442 |
| 305 | 3300012803 | Ga0160465_101080 | Ga0160465_1010806 | 443 |
| 306 | 3300042591 | Ga0466692_145287 | Ga0466692_145287_25220_26551 | 443 |
| 307 | 3300012848 | Ga0160443_100020 | Ga0160443_100020358 | 445 |
| 308 | 3300042609 | Ga0466722_055790 | Ga0466722_055790_10014_11351 | 445 |
| 309 | 3300042643 | Ga0466704_042237 | Ga0466704_042237_14_1357 | 447 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00483 | GO:0009058 | biosynthetic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.