Protein Family IF09321

Metagenome Isolate
309 Members
247 Samples
130 Scaffolds
410.12 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_042237|Ga0466704_042237_14_1357
Length
447 aa
Sequence
MWSVERKVSSEDVLKSAIHEERGQMREKRTFQLPGMTVALVLAGGRGSRLYELTDRRAKPAVYFGGKYRIVDFAMSNCVNSGIRRIGVVTQYKSHSLLRHIQRGWGFLRGEDNEFIDLLPAQQRVDEESWYRGTADAVYQNIDIIETFRPVPKYVLILAGDHVYKMNYAAMLVDHAESGAECTVACIEVPRRDAKGFGVMAVDESDRIVDFVEKPADPPAMPGKPESSLCSMGIYIFNAEYLYNELKRDIDDPTSSHDFGKDIIPQAVRNGVASAHSFDRSCVHAPEEGPNKENYWRDAGTVDAYWEANIDLTATDPALNLYDYNWPVWTYQQQLPPAKFVHNQIDRHGVAIESMVSGGCIISGELNRSLLFSSCRVHSYSRINWSVLLPQVEVGRNARLNRCVIDHGVFIPPGLVIGENPDEDARRFRRTGNGVILVTRQMIERLR

πŸ“Š Sample Types

Isolate 57.9%
Metagenome 42.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 34.6%
Unclassified 22.9%
Termitidae 10.8%
Blattidae 5.2%
Kalotermitidae 5.2%
Armadillidiidae 2.2%
Culicidae 2.2%
Elmidae 2.2%
Ixodidae 1.7%
Drosophilidae 1.7%
Rhinotermitidae 1.3%
Palinuridae 1.3%
Tenebrionidae 1.3%
Termopsidae 1.3%
Argasidae 0.9%
Talitridae 0.9%
Passalidae 0.9%
Berytidae 0.9%
Nephropidae 0.4%
Daphniidae 0.4%
Hodotermitidae 0.4%
Artemiidae 0.4%
Alydidae 0.4%
Penaeidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 293
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2506210010 Francisella tularensis tularensis FSC041 Isolate
2 2506210015 Francisella tularensis holarctica FSC185 Isolate
3 2511231129 Vibrio sp. EJY3 Isolate Unclassified
4 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
5 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
6 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
7 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
8 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
9 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
10 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
11 2908136803 Vibrio owensii 1700302 Isolate Unclassified
12 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
13 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 637000113 Francisella tularensis tularensis FSC 198 Isolate
19 640963010 Vibrio harveyi HY01 Isolate Unclassified
20 8022345672 Vibrio sp. 070316B Isolate Unclassified
21 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
22 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
23 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
24 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
25 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
26 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
27 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
28 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
29 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
30 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
31 8102102351 Caballeronia sp. INML1 Isolate Coreidae
32 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
33 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
34 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
35 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
36 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2556921669 Shinella sp. DD12 Isolate Daphniidae
41 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
42 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
43 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
44 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
45 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
46 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
47 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
48 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
49 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
50 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
51 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
52 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
53 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
54 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
55 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
56 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
57 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
58 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
59 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
60 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
61 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
62 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
63 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
64 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
65 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
66 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
67 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
68 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
69 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
70 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
71 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
72 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
73 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
74 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
75 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
76 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
77 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
78 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
79 2850895757 Vibrio campbellii 170502 Isolate Unclassified
80 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
81 2871595141 Francisella tularensis 503 Isolate Ixodidae
82 2872471378 Vibrio owensii V180403 Isolate Unclassified
83 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
84 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
85 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
86 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
87 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
88 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
89 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
90 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
91 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
92 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
93 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
94 8102117041 Caballeronia sp. INML3 Isolate Coreidae
95 8102131453 Caballeronia sp. INML5 Isolate Coreidae
96 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
97 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
98 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
99 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
100 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
101 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
102 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
103 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
104 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
105 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
106 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
107 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
108 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
109 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
110 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
111 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
112 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
113 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
114 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
115 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
116 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
117 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
118 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
119 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
120 8023757577 Caballeronia peredens LP006 Isolate Coreidae
121 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
122 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
123 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
124 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
125 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
126 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
127 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
128 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
129 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
130 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
131 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
132 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
133 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
134 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
135 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
136 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
137 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
138 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
139 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
140 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
141 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
142 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
143 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
144 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
145 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
146 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
147 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
148 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
149 8102124461 Caballeronia sp. INML3B Isolate Coreidae
150 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
151 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
152 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
153 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
154 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
155 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
156 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
157 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
158 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
159 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
160 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
161 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
162 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
163 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
164 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
165 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
166 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
167 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
168 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
169 2912570088 Vibrio parahaemolyticus CHN25 Isolate
170 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
171 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
172 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
173 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
174 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
175 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
176 8051551332 Vibrio vulnificus Vv003 Isolate
177 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
178 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
179 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
180 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
181 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
182 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
183 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
184 2684622551 Vibrio campbellii E1 Isolate Unclassified
185 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
186 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
187 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
188 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
189 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
190 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
191 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
192 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
193 8022096067 Vibrio sp. SALL6 Isolate Unclassified
194 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
195 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
196 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
197 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
198 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
199 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
200 8051461712 Vibrio vulnificus Vv002 Isolate
201 8060845732 Vibrio vulnificus Vv006 Isolate
202 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
203 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
204 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
205 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
206 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
207 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
208 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
209 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
210 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
211 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
212 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
213 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
214 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
215 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
216 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
217 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
218 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
219 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
220 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
221 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
222 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
223 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
224 2791355473 Vibrio barjaei 3062 Isolate Unclassified
225 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
226 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
227 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
228 8051534459 Vibrio vulnificus Vv004 Isolate
229 8069748016 Caballeronia sp. LP003 Isolate Coreidae
230 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
231 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
232 8102109360 Caballeronia sp. INML2 Isolate Coreidae
233 8102145433 Caballeronia sp. LP006 Isolate Coreidae
234 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
235 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
236 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
237 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
238 3006242587 Vibrio sp. RE86 Isolate Unclassified
239 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
240 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
241 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
242 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
243 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
244 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
245 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
246 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
247 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_198103 3300042635 Bacteria 2774
2 Ga0466704_042237 3300042643 Bacteria 1429
3 Ga0466709_049894 3300042648 Unclassified 53806
4 Ga0466724_31439 3300042649 Bacteria 9380
5 Ga0466727_080583 3300042655 Bacteria 8696
6 Ga0466706_074539 3300042599 Bacteria 137679
7 Ga0123356_10006381 3300010049 Bacteria 11883
8 Ga0466710_209366 3300042613 Bacteria 5797
9 Ga0466657_113751 3300042582 Bacteria 130632
10 Ga0466699_116488 3300042597 Bacteria 2745
11 Ga0466735_078916 3300042624 Bacteria 6122
12 Ga0466706_087956 3300042599 Bacteria 6007
13 Ga0466720_017237 3300042607 Bacteria 16171
14 Ga0123353_10000040 3300010167 Bacteria 139340
15 Ga0466711_390078 3300042615 Bacteria 32121
16 Ga0466715_409945 3300042616 Unclassified 67330
17 Ga0160455_100022 3300012837 Bacteria 376035
18 Ga0160472_100173 3300012839 Unclassified 86925
19 Ga0466696_385317 3300042596 Bacteria 6250
20 JGI24700J35501_10930601 3300002508 Bacteria 16421
21 JGI24700J35501_10930603 3300002508 Bacteria 16440
22 Ga0466705_180755 3300042612 Unclassified 2499
23 Ga0562376_0081 3300056857 Bacteria 226138
24 Ga0466709_339590 3300042648 Bacteria 5218
25 Ga0466724_25733 3300042649 Bacteria 9630
26 Ga0466706_272622 3300042599 Unclassified 7974
27 Ga0123356_10004192 3300010049 Bacteria 14942
28 Ga0123356_10458155 3300010049 Bacteria 1424
29 Ga0466705_436923 3300042612 Bacteria 7832
30 Ga0466712_232413 3300042614 Bacteria 21480
31 Ga0466715_310632 3300042616 Bacteria 3353
32 Ga0466718_147373 3300042617 Bacteria 11031
33 Ga0466726_083459 3300042619 Bacteria 2394
34 Ga0466726_363045 3300042619 Unclassified 6586
35 Ga0466729_168231 3300042621 Bacteria 9378
36 Ga0160469_100210 3300012824 Bacteria 50416
37 Ga0160430_108566 3300012852 Bacteria 1921
38 Ga0466691_104899 3300042593 Bacteria 9924
39 2227080779 2225789004 Bacteria 173520
40 Ga0123357_10000609 3300009784 Bacteria 35481
41 Ga0466703_384890 3300042636 Bacteria 3182
42 Ga0466725_130312 3300042654 Bacteria 15939
43 Ga0466706_004221 3300042599 Bacteria 8739
44 Ga0466722_055790 3300042609 Bacteria 11661
45 Ga0123356_10125115 3300010049 Unclassified 2508
46 Ga0160454_100487 3300012798 Bacteria 14283
47 Ga0160471_102359 3300012812 Bacteria 3163
48 Ga0466718_157466 3300042617 Bacteria 5577
49 Ga0466726_024792 3300042619 Bacteria 26336
50 Ga0466729_152338 3300042621 Bacteria 104951
51 Ga0160447_100927 3300012849 Bacteria 12313
52 Ga0466692_145287 3300042591 Bacteria 39430
53 Ga0466701_015229 3300042598 Bacteria 10106
54 Ga0072940_1080275 3300005200 Bacteria 4037
55 Ga0123357_10000734 3300009784 Bacteria 33022
56 Ga0466727_157224 3300042655 Bacteria 8350
57 Ga0466717_290119 3300042604 Bacteria 2833
58 Ga0466716_183516 3300042605 Bacteria 11086
59 Ga0466722_164655 3300042609 Bacteria 24827
60 Ga0466722_220136 3300042609 Bacteria 5174
61 Ga0123355_10146644 3300009826 Unclassified 3597
62 Ga0466710_254735 3300042613 Bacteria 2127
63 Ga0466711_273053 3300042615 Bacteria 15842
64 Ga0466723_325720 3300042618 Bacteria 2670
65 Ga0160448_100320 3300012854 Bacteria 17927
66 Ga0264413_130089 3300024493 Bacteria 2926
67 Ga0466701_004108 3300042598 Bacteria 13088
68 Ga0068305_10662626 3300005083 Bacteria 1447
69 Ga0072941_1123023 3300005201 Bacteria 3429
70 Ga0466735_144028 3300042624 Bacteria 1728
71 Ga0466706_032431 3300042599 Bacteria 50635
72 Ga0466706_200541 3300042599 Bacteria 48383
73 Ga0466706_229988 3300042599 Bacteria 8411
74 Ga0466706_283701 3300042599 Bacteria 11721
75 Ga0466700_421632 3300042600 Bacteria 2556
76 Ga0466707_006107 3300042601 Bacteria 44573
77 Ga0123353_10000443 3300010167 Bacteria 51439
78 Ga0160465_101080 3300012803 Bacteria 8768
79 Ga0160466_100063 3300012809 Bacteria 125464
80 Ga0160471_100192 3300012812 Bacteria 22155
81 Ga0466710_217703 3300042613 Bacteria 3373
82 Ga0160440_100092 3300012815 Unclassified 101876
83 Ga0160433_100097 3300012846 Bacteria 88061
84 Ga0160448_105441 3300012854 Bacteria 3332
85 Ga0265387_1000025 3300024582 Bacteria 63430
86 Ga0466695_049622 3300042595 Bacteria 26917
87 Ga0466699_101882 3300042597 Bacteria 6010
88 Ga0466699_152342 3300042597 Unclassified 1727
89 JGI24698J34947_10059177 3300002449 Bacteria 1895
90 Ga0466697_120553 3300042611 Bacteria 2779
91 Ga0562378_0459 3300056814 Bacteria 69701
92 Ga0466734_082283 3300042623 Bacteria 7876
93 Ga0466704_363902 3300042643 Bacteria 140929
94 Ga0466709_283453 3300042648 Bacteria 4003
95 Ga0466724_32630 3300042649 Bacteria 13538
96 Ga0466706_059862 3300042599 Bacteria 15934
97 Ga0466706_169919 3300042599 Bacteria 11913
98 Ga0466713_054975 3300042602 Unclassified 3152
99 Ga0466722_008722 3300042609 Bacteria 4421
100 Ga0123356_10018642 3300010049 Bacteria 6586
101 Ga0466710_317641 3300042613 Bacteria 36750
102 Ga0466718_074789 3300042617 Bacteria 15598
103 Ga0466723_070255 3300042618 Bacteria 28764
104 Ga0466726_425806 3300042619 Bacteria 8348
105 Ga0466728_370042 3300042620 Bacteria 4210
106 Ga0466657_219053 3300042582 Bacteria 26717
107 Ga0466691_044915 3300042593 Bacteria 21854
108 Ga0466694_372464 3300042594 Bacteria 1319
109 IMNBL1DRAFT_c0018833 3300000062 Bacteria 2854
110 AustNasuHG_c1008698 3300000089 Bacteria 3593
111 Ga0466705_383529 3300042612 Bacteria 10943
112 Ga0562374_1417 3300057007 Unclassified 28023
113 Ga0466725_187893 3300042654 Bacteria 24541
114 Ga0466706_004763 3300042599 Unclassified 33253
115 Ga0466706_140683 3300042599 Bacteria 7002
116 Ga0466717_290149 3300042604 Unclassified 1786
117 Ga0123355_10156936 3300009826 Unclassified 3440
118 Ga0123356_10156848 3300010049 Unclassified 2268
119 Ga0160470_100050 3300012813 Bacteria 172769
120 Ga0466726_278972 3300042619 Bacteria 29992
121 Ga0160470_101171 3300012813 Bacteria 6882
122 Ga0160467_100219 3300012829 Bacteria 73493
123 Ga0160443_100020 3300012848 Bacteria 410950
124 Ga0160430_102382 3300012852 Bacteria 5997
125 Ga0466690_080050 3300042590 Bacteria 2647
126 Ga0466696_010114 3300042596 Bacteria 17230
127 Ga0466699_422540 3300042597 Bacteria 6738
128 IMNBL1DRAFT_c0009347 3300000062 Bacteria 4848
129 Ga0068305_10004492 3300005083 Bacteria 39529
130 Ga0072940_1109148 3300005200 Bacteria 6837

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_390078 Ga0466711_390078_14044_15207 320
2 3300042599 Ga0466706_272622 Ga0466706_272622_3321_4523 326
3 3300042599 Ga0466706_140683 Ga0466706_140683_5210_6328 333
4 3300042599 Ga0466706_032431 Ga0466706_032431_28263_29465 337
5 3300042599 Ga0466706_200541 Ga0466706_200541_27047_28249 337
6 3300042599 Ga0466706_229988 Ga0466706_229988_1637_2839 339
7 3300042599 Ga0466706_087956 Ga0466706_087956_2664_3878 340
8 3300024493 Ga0264413_130089 Ga0264413_1300893 344
9 3300002508 JGI24700J35501_10930601 JGI24700J35501_109306015 346
10 3300010167 Ga0123353_10000443 Ga0123353_100004438 347
11 3300010049 Ga0123356_10156848 Ga0123356_101568482 353
12 3300010049 Ga0123356_10125115 Ga0123356_101251151 354
13 3300042599 Ga0466706_059862 Ga0466706_059862_12777_13952 355
14 3300042619 Ga0466726_363045 Ga0466726_363045_2739_3938 357
15 3300010049 Ga0123356_10006381 Ga0123356_100063815 360
16 3300042599 Ga0466706_004763 Ga0466706_004763_29550_30752 363
17 3300042599 Ga0466706_004221 Ga0466706_004221_1482_2684 364
18 3300042599 Ga0466706_074539 Ga0466706_074539_43536_44726 364
19 3300042618 Ga0466723_325720 Ga0466723_325720_1330_2523 367
20 3300042604 Ga0466717_290149 Ga0466717_290149_448_1671 369
21 3300042655 Ga0466727_080583 Ga0466727_080583_3796_4995 372
22 3300012852 Ga0160430_102382 Ga0160430_1023822 373
23 3300002508 JGI24700J35501_10930603 JGI24700J35501_109306034 375
24 3300042597 Ga0466699_152342 Ga0466699_152342_125_1303 375
25 iso_pr_bacteria 2585428085 2587835849 378
26 2225789004 2227080779 2227452391 379
27 3300042595 Ga0466695_049622 Ga0466695_049622_2213_3391 382
28 3300000089 AustNasuHG_c1008698 AustNasuHG_10086984 383
29 iso_pr_bacteria 2788499854 2788759877 383
30 iso_pr_bacteria 2940352027 2940352777 383
31 iso_pr_bacteria 2940354458 2940355208 383
32 iso_pr_bacteria 2940356891 2940357642 383
33 iso_pr_bacteria 2940359323 2940360183 383
34 iso_pr_bacteria 2940361758 2940362617 383
35 iso_pr_bacteria 2940364193 2940365061 383
36 iso_pr_bacteria 2940366561 2940367490 383
37 iso_pr_bacteria 2940368928 2940369768 383
38 3300042597 Ga0466699_422540 Ga0466699_422540_4502_5680 384
39 3300042616 Ga0466715_409945 Ga0466715_409945_11072_12346 384
40 3300042597 Ga0466699_101882 Ga0466699_101882_1457_2635 386
41 3300042601 Ga0466707_006107 Ga0466707_006107_32136_33410 386
42 3300042648 Ga0466709_049894 Ga0466709_049894_11565_12839 386
43 3300000062 IMNBL1DRAFT_c0009347 IMNBL1DRAFT_00093474 387
44 3300005083 Ga0068305_10004492 Ga0068305_100044929 387
45 3300042602 Ga0466713_054975 Ga0466713_054975_1467_2741 387
46 3300042617 Ga0466718_157466 Ga0466718_157466_1276_2493 387
47 3300042612 Ga0466705_436923 Ga0466705_436923_1261_2532 389
48 3300012812 Ga0160471_100192 Ga0160471_10019214 390
49 3300012813 Ga0160470_101171 Ga0160470_1011714 390
50 iso_pr_bacteria 2940236825 2940237768 390
51 iso_pr_bacteria 2940339133 2940340177 390
52 iso_pr_bacteria 2940341480 2940342667 390
53 iso_pr_bacteria 2940343849 2940344973 390
54 3300000062 IMNBL1DRAFT_c0018833 IMNBL1DRAFT_00188333 391
55 3300042594 Ga0466694_372464 Ga0466694_372464_106_1284 392
56 3300005200 Ga0072940_1109148 Ga0072940_11091485 393
57 3300012837 Ga0160455_100022 Ga0160455_100022146 393
58 3300042635 Ga0466702_198103 Ga0466702_198103_178_1362 394
59 3300009784 Ga0123357_10000609 Ga0123357_100006095 395
60 3300010049 Ga0123356_10458155 Ga0123356_104581551 395
61 3300042648 Ga0466709_339590 Ga0466709_339590_49_1236 395
62 3300012854 Ga0160448_105441 Ga0160448_1054412 396
63 3300042599 Ga0466706_169919 Ga0466706_169919_3390_4691 396
64 3300005200 Ga0072940_1080275 Ga0072940_10802753 397
65 3300009826 Ga0123355_10146644 Ga0123355_101466442 397
66 3300009826 Ga0123355_10156936 Ga0123355_101569361 397
67 3300010049 Ga0123356_10018642 Ga0123356_100186426 398
68 3300042596 Ga0466696_010114 Ga0466696_010114_5776_6972 398
69 3300042605 Ga0466716_183516 Ga0466716_183516_1640_2836 398
70 3300042616 Ga0466715_310632 Ga0466715_310632_1334_2530 398
71 3300010049 Ga0123356_10004192 Ga0123356_100041925 399
72 3300012798 Ga0160454_100487 Ga0160454_1004873 399
73 3300042619 Ga0466726_278972 Ga0466726_278972_18963_20162 399
74 3300042619 Ga0466726_425806 Ga0466726_425806_5201_6400 399
75 3300042607 Ga0466720_017237 Ga0466720_017237_4761_6026 400
76 3300012852 Ga0160430_108566 Ga0160430_1085662 401
77 3300042598 Ga0466701_015229 Ga0466701_015229_7924_9240 402
78 iso_pr_bacteria 2820418027 2820418671 402
79 3300042621 Ga0466729_152338 Ga0466729_152338_52311_53564 403
80 iso_pr_bacteria 2511231129 2511733529 404
81 iso_pr_bacteria 2531839005 2531869301 404
82 iso_pr_bacteria 2551306507 2553348262 404
83 iso_pr_bacteria 2565956518 2566025367 404
84 iso_pr_bacteria 2571042430 2572514416 404
85 iso_pr_bacteria 2571042554 2572927825 404
86 iso_pr_bacteria 2648501158 2648748306 404
87 iso_pr_bacteria 2654587515 2654660811 404
88 iso_pr_bacteria 2663763317 2666539076 404
89 iso_pr_bacteria 2667527830 2669649491 404
90 iso_pr_bacteria 2667527887 2669891592 404
91 iso_pr_bacteria 2684622551 2684820515 404
92 iso_pr_bacteria 2693429575 2693741666 404
93 iso_pr_bacteria 2700989396 2702439357 404
94 iso_pr_bacteria 2731957638 2732531729 404
95 iso_pr_bacteria 2785510762 2785801847 404
96 iso_pr_bacteria 2791355471 2794373621 404
97 iso_pr_bacteria 2850895757 2850900000 404
98 iso_pr_bacteria 2860776474 2860780026 404
99 iso_pr_bacteria 2872471378 2872476440 404
100 iso_pr_bacteria 2875320051 2875324951 404
101 iso_pr_bacteria 2877638525 2877642972 404
102 iso_pr_bacteria 2877647439 2877652050 404
103 iso_pr_bacteria 2880115952 2880120410 404
104 iso_pr_bacteria 2908136803 2908141239 404
105 iso_pr_bacteria 2912570088 2912574125 404
106 iso_pr_bacteria 2989793055 2989794820 404
107 iso_pr_bacteria 2997380424 2997385267 404
108 iso_pr_bacteria 3006225627 3006229061 404
109 iso_pr_bacteria 8008122225 8008124818 404
110 iso_pr_bacteria 8022096067 8022097274 404
111 iso_pr_bacteria 8042061949 8042065148 404
112 iso_pr_bacteria 8051461712 8051463654 404
113 iso_pr_bacteria 8051534459 8051536646 404
114 iso_pr_bacteria 8051551332 8051556016 404
115 iso_pr_bacteria 8060845732 8060846091 404
116 3300012829 Ga0160467_100219 Ga0160467_10021914 405
117 3300042599 Ga0466706_283701 Ga0466706_283701_4101_5414 405
118 3300042604 Ga0466717_290119 Ga0466717_290119_975_2192 405
119 iso_pr_bacteria 2600255074 2600846920 405
120 iso_pr_bacteria 2711768158 2712479426 405
121 iso_pr_bacteria 2820946191 2820946556 405
122 iso_pr_bacteria 3006242587 3006244069 405
123 iso_pr_bacteria 8022439116 8022439916 405
124 iso_pr_bacteria 8033364368 8033365765 405
125 iso_pr_bacteria 8033368880 8033370957 405
126 iso_pr_bacteria 2791355473 2794385965 406
127 3300012846 Ga0160433_100097 Ga0160433_10009793 407
128 3300012809 Ga0160466_100063 Ga0160466_100063113 409
129 3300042600 Ga0466700_421632 Ga0466700_421632_491_1813 410
130 3300042612 Ga0466705_180755 Ga0466705_180755_1107_2339 410
131 3300042617 Ga0466718_074789 Ga0466718_074789_4472_5734 410
132 3300042636 Ga0466703_384890 Ga0466703_384890_10_1242 410
133 3300042655 Ga0466727_157224 Ga0466727_157224_2606_3838 410
134 3300010167 Ga0123353_10000040 Ga0123353_1000004051 411
135 3300042590 Ga0466690_080050 Ga0466690_080050_482_1717 411
136 3300042593 Ga0466691_104899 Ga0466691_104899_1615_2850 411
137 3300042618 Ga0466723_070255 Ga0466723_070255_27328_28563 411
138 3300042620 Ga0466728_370042 Ga0466728_370042_1369_2604 411
139 3300042593 Ga0466691_044915 Ga0466691_044915_569_1807 412
140 3300042617 Ga0466718_147373 Ga0466718_147373_8901_10229 413
141 iso_pr_bacteria 637000113 640742736 413
142 3300005201 Ga0072941_1123023 Ga0072941_11230232 415
143 3300042598 Ga0466701_004108 Ga0466701_004108_858_2180 415
144 3300012824 Ga0160469_100210 Ga0160469_1002106 417
145 iso_pr_bacteria 2912636047 2912640345 417
146 iso_pr_bacteria 8022116796 8022119215 417
147 iso_pr_bacteria 8022345672 8022347913 417
148 3300042597 Ga0466699_116488 Ga0466699_116488_389_1651 420
149 iso_pr_bacteria 2556921669 2558279847 420
150 iso_pr_bacteria 2820115951 2820117726 420
151 iso_pr_bacteria 2820947865 2820948972 420
152 iso_pr_bacteria 2864976888 2864977860 420
153 3300012813 Ga0160470_100050 Ga0160470_10005023 421
154 3300012849 Ga0160447_100927 Ga0160447_1009279 421
155 3300012839 Ga0160472_100173 Ga0160472_10017376 422
156 3300024582 Ga0265387_1000025 Ga0265387_100002553 422
157 3300042596 Ga0466696_385317 Ga0466696_385317_2949_4217 422
158 3300042609 Ga0466722_164655 Ga0466722_164655_19759_21027 422
159 iso_pr_bacteria 2597489944 2598060590 422
160 iso_pr_bacteria 2772190782 2772999693 422
161 iso_pr_bacteria 2806310685 2807226967 422
162 iso_pr_bacteria 2864993140 2864993680 422
163 iso_pr_bacteria 2873468275 2873468815 422
164 3300042609 Ga0466722_008722 Ga0466722_008722_302_1573 423
165 3300042609 Ga0466722_220136 Ga0466722_220136_1618_2889 423
166 3300042612 Ga0466705_383529 Ga0466705_383529_7257_8528 423
167 3300042614 Ga0466712_232413 Ga0466712_232413_15933_17204 423
168 3300042615 Ga0466711_273053 Ga0466711_273053_11792_13063 423
169 3300042619 Ga0466726_083459 Ga0466726_083459_314_1585 423
170 3300042621 Ga0466729_168231 Ga0466729_168231_7237_8508 423
171 3300042624 Ga0466735_078916 Ga0466735_078916_4445_5716 423
172 3300042624 Ga0466735_144028 Ga0466735_144028_78_1349 423
173 3300042643 Ga0466704_363902 Ga0466704_363902_32491_33762 423
174 3300042648 Ga0466709_283453 Ga0466709_283453_489_1760 423
175 iso_pr_bacteria 2506210010 2506291012 423
176 iso_pr_bacteria 2506210015 2506302325 423
177 iso_pr_bacteria 2871564055 2871565442 423
178 iso_pr_bacteria 2871595141 2871596520 423
179 iso_pr_bacteria 2874203443 2874204822 423
180 iso_pr_bacteria 2874209778 2874211542 423
181 iso_pr_bacteria 2889908211 2889910917 423
182 iso_pr_bacteria 8025701579 8025702373 423
183 iso_pr_bacteria 8025728939 8025733856 423
184 iso_pr_bacteria 8102174626 8102179543 423
185 iso_pr_bacteria 8102201977 8102202771 423
186 3300002449 JGI24698J34947_10059177 JGI24698J34947_100591771 424
187 3300005083 Ga0068305_10662626 Ga0068305_106626261 424
188 3300012812 Ga0160471_102359 Ga0160471_1023593 424
189 3300012854 Ga0160448_100320 Ga0160448_1003205 424
190 iso_pr_bacteria 2820123897 2820126866 424
191 iso_pr_bacteria 2820309449 2820310686 424
192 iso_pr_bacteria 8023724303 8023726629 424
193 iso_pr_bacteria 8023747282 8023748688 424
194 iso_pr_bacteria 8023752828 8023752961 424
195 iso_pr_bacteria 8023757577 8023759903 424
196 iso_pr_bacteria 8023764196 8023768095 424
197 iso_pr_bacteria 8024001094 8024004792 424
198 iso_pr_bacteria 8024014383 8024017845 424
199 iso_pr_bacteria 8024019580 8024023058 424
200 iso_pr_bacteria 8024025509 8024029006 424
201 iso_pr_bacteria 8024037630 8024041183 424
202 iso_pr_bacteria 8024044713 8024047998 424
203 iso_pr_bacteria 8025650824 8025657039 424
204 iso_pr_bacteria 8025658853 8025664698 424
205 iso_pr_bacteria 8025666332 8025670544 424
206 iso_pr_bacteria 8025671076 8025677248 424
207 iso_pr_bacteria 8025678175 8025684342 424
208 iso_pr_bacteria 8025685901 8025693076 424
209 iso_pr_bacteria 8025694439 8025700482 424
210 iso_pr_bacteria 8025708040 8025713957 424
211 iso_pr_bacteria 8025716094 8025721346 424
212 iso_pr_bacteria 8025723035 8025727922 424
213 iso_pr_bacteria 8025735396 8025738896 424
214 iso_pr_bacteria 8025740903 8025746663 424
215 iso_pr_bacteria 8025747911 8025753725 424
216 iso_pr_bacteria 8025756023 8025761839 424
217 iso_pr_bacteria 8069748016 8069753288 424
218 iso_pr_bacteria 8069755105 8069760919 424
219 iso_pr_bacteria 8069763219 8069768979 424
220 iso_pr_bacteria 8069770227 8069771633 424
221 iso_pr_bacteria 8069775773 8069775906 424
222 iso_pr_bacteria 8078130113 8078133652 424
223 iso_pr_bacteria 8101951471 8101955053 424
224 iso_pr_bacteria 8101960468 8101964009 424
225 iso_pr_bacteria 8101967387 8101970988 424
226 iso_pr_bacteria 8101974301 8101977783 424
227 iso_pr_bacteria 8101981714 8101985049 424
228 iso_pr_bacteria 8101988189 8101991596 424
229 iso_pr_bacteria 8101994502 8101998065 424
230 iso_pr_bacteria 8102001125 8102004403 424
231 iso_pr_bacteria 8102007614 8102011160 424
232 iso_pr_bacteria 8102014801 8102018431 424
233 iso_pr_bacteria 8102020860 8102024078 424
234 iso_pr_bacteria 8102026984 8102030424 424
235 iso_pr_bacteria 8102033761 8102037627 424
236 iso_pr_bacteria 8102041249 8102044539 424
237 iso_pr_bacteria 8102047609 8102051126 424
238 iso_pr_bacteria 8102054868 8102058133 424
239 iso_pr_bacteria 8102060671 8102064260 424
240 iso_pr_bacteria 8102067727 8102071236 424
241 iso_pr_bacteria 8102074813 8102078374 424
242 iso_pr_bacteria 8102081745 8102085214 424
243 iso_pr_bacteria 8102087471 8102090701 424
244 iso_pr_bacteria 8102094248 8102097759 424
245 iso_pr_bacteria 8102102351 8102105798 424
246 iso_pr_bacteria 8102109360 8102112817 424
247 iso_pr_bacteria 8102117041 8102120534 424
248 iso_pr_bacteria 8102124461 8102127943 424
249 iso_pr_bacteria 8102131453 8102132604 424
250 iso_pr_bacteria 8102138357 8102141801 424
251 iso_pr_bacteria 8102145433 8102147759 424
252 iso_pr_bacteria 8102152052 8102155951 424
253 iso_pr_bacteria 8102161003 8102163825 424
254 iso_pr_bacteria 8102169119 8102172619 424
255 iso_pr_bacteria 8102181083 8102185970 424
256 iso_pr_bacteria 8102186987 8102192237 424
257 iso_pr_bacteria 8102193924 8102199839 424
258 iso_pr_bacteria 8102208438 8102214653 424
259 iso_pr_bacteria 8102216467 8102222510 424
260 iso_pr_bacteria 8102223607 8102229779 424
261 iso_pr_bacteria 8102230706 8102237881 424
262 iso_pr_bacteria 8102239244 8102245409 424
263 iso_pr_bacteria 8102246966 8102251178 424
264 iso_pr_bacteria 8102251710 8102257555 424
265 iso_pr_bacteria 8102264549 8102267986 424
266 iso_pr_bacteria 8102271933 8102275375 424
267 iso_pr_bacteria 8102279326 8102282956 424
268 iso_pr_bacteria 8102286609 8102290163 424
269 iso_pr_bacteria 8102312426 8102315720 424
270 3300009784 Ga0123357_10000734 Ga0123357_1000073413 425
271 3300012815 Ga0160440_100092 Ga0160440_10009282 425
272 3300042619 Ga0466726_024792 Ga0466726_024792_9642_10919 425
273 iso_pr_bacteria 2820298281 2820300343 425
274 iso_pr_bacteria 640963010 641027910 425
275 iso_pr_bacteria 2864808494 2864810216 426
276 iso_pr_bacteria 2864812326 2864814048 426
277 iso_pr_bacteria 2820492969 2820495133 428
278 3300042582 Ga0466657_219053 Ga0466657_219053_11720_13009 429
279 3300042582 Ga0466657_113751 Ga0466657_113751_71106_72413 435
280 3300042613 Ga0466710_317641 Ga0466710_317641_19673_20980 435
281 3300042654 Ga0466725_130312 Ga0466725_130312_4369_5676 435
282 3300042649 Ga0466724_25733 Ga0466724_25733_5984_7294 436
283 3300042649 Ga0466724_32630 Ga0466724_32630_5824_7134 436
284 3300056857 Ga0562376_0081 Ga0562376_0081_90146_91456 436
285 3300057007 Ga0562374_1417 Ga0562374_1417_21913_23223 436
286 iso_pr_bacteria 2841260384 2841262712 436
287 iso_pr_bacteria 8101676404 8101678700 436
288 iso_pr_bacteria 8101680043 8101683521 436
289 iso_pr_bacteria 8101683685 8101684292 436
290 iso_pr_bacteria 2791355473 2794383332 437
291 iso_pr_bacteria 2820152154 2820154477 437
292 3300042623 Ga0466734_082283 Ga0466734_082283_4504_5820 438
293 3300042654 Ga0466725_187893 Ga0466725_187893_8285_9601 438
294 3300042613 Ga0466710_209366 Ga0466710_209366_680_1999 439
295 3300042613 Ga0466710_217703 Ga0466710_217703_673_1992 439
296 3300042613 Ga0466710_254735 Ga0466710_254735_589_1908 439
297 3300056814 Ga0562378_0459 Ga0562378_0459_61311_62630 439
298 iso_pr_bacteria 2820084079 2820084092 439
299 iso_pr_bacteria 2820086750 2820086800 439
300 3300042649 Ga0466724_31439 Ga0466724_31439_3853_5175 440
301 3300042611 Ga0466697_120553 Ga0466697_120553_135_1460 441
302 iso_pr_bacteria 2820161938 2820163065 441
303 iso_pr_bacteria 2820164216 2820164509 441
304 iso_pr_bacteria 2756170277 2756797662 442
305 3300012803 Ga0160465_101080 Ga0160465_1010806 443
306 3300042591 Ga0466692_145287 Ga0466692_145287_25220_26551 443
307 3300012848 Ga0160443_100020 Ga0160443_100020358 445
308 3300042609 Ga0466722_055790 Ga0466722_055790_10014_11351 445
309 3300042643 Ga0466704_042237 Ga0466704_042237_14_1357 447

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00483 NTP_transferase Nucleotidyl transferase 39 313 0.96
PF12804 NTP_transf_3 MobA-like NTP transferase domain 39 186 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.