Protein Family IF09286

Metagenome Isolate
137 Members
70 Samples
120 Scaffolds
306.78 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_373673|Ga0466703_373673_4573_5580
Length
335 aa
Sequence
MRLFFIRSLFGLKIFMYLCTQNKKMNNEQIDINQFRPLGNIEIIAKQLVEGFITGLHKSPFHGFSVEFAEYRPYNTGESTRNIDWKLYGRTDKLFVKQYEEETNLRCQVIMDTSSSMYFPQRQKLSLEHPNKIYFSVYAAAAIMQIMKQQRDAIGLSLFSDSVYFHSQAKSSAIHLKSLYHELEHLLIPIPINEQHGTNVTNSLHEVAERIHRRSLVVIFSDVFDNSKQEDLFLALQHLKHNKHDVILFHVYDKSLEIDFDFDNKPYKFIDVESGNTLKVNASEIKTHYRKAIKAFKDELKVRCGQYQVDLVETDINQGFHHVMLTYLLKRQRLF

📊 Sample Types

Isolate 12.4%
Metagenome 87.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.3%
Unclassified 20.9%
Kalotermitidae 17.9%
Passalidae 3.0%
Formicidae 3.0%
Rhinotermitidae 3.0%
Termopsidae 3.0%
Armadillidiidae 3.0%
Hodotermitidae 1.5%
Elmidae 1.5%
Daphniidae 1.5%
Apidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
2 2882250448 Bizionia sp. APA-3 Isolate
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
13 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
18 2864836148 Arcicella rosea S00070 Isolate Elmidae
19 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
20 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
21 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
22 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
32 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
33 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
34 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
41 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
47 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
53 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
61 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
62 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
63 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
66 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
67 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
68 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
69 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_065509 3300042659 Bacteria 7512
2 Ga0466706_143471 3300042599 Bacteria 19207
3 Ga0466713_105299 3300042602 Bacteria 19535
4 Ga0123355_10158466 3300009826 Bacteria 3417
5 Ga0123355_10438499 3300009826 Bacteria 1655
6 Ga0123353_10534042 3300010167 Bacteria 1697
7 Ga0123354_10292605 3300010882 Unclassified 1557
8 Ga0466693_366921 3300042592 Bacteria 3318
9 Ga0466691_013866 3300042593 Bacteria 4153
10 Ga0466695_067706 3300042595 Bacteria 1228
11 Ga0466696_378508 3300042596 Bacteria 10746
12 Ga0466699_189306 3300042597 Bacteria 1772
13 Ga0466709_324730 3300042648 Bacteria 12059
14 JGI24705J35276_12181310 3300002504 Bacteria 1371
15 JGI24696J40584_12960630 3300002834 Unclassified 7839
16 Ga0072940_1486056 3300005200 Bacteria 1350
17 Ga0103267_1000039 3300007190 Bacteria 55786
18 Ga0103268_1001855 3300007192 Bacteria 4923
19 Ga0466705_101462 3300042612 Bacteria 9396
20 Ga0466710_130006 3300042613 Bacteria 3298
21 Ga0466711_283396 3300042615 Bacteria 10741
22 Ga0466706_058902 3300042599 Bacteria 65436
23 Ga0466713_076070 3300042602 Bacteria 23767
24 Ga0466717_251260 3300042604 Bacteria 2524
25 Ga0466722_135473 3300042609 Bacteria 2963
26 Ga0466698_267174 3300042610 Bacteria 1105
27 Ga0123355_10000308 3300009826 Bacteria 62784
28 Ga0123353_10580715 3300010167 Bacteria 1608
29 Ga0466656_313302 3300042550 Bacteria 2583
30 Ga0466696_203255 3300042596 Bacteria 7801
31 Ga0466696_407626 3300042596 Bacteria 1230
32 Ga0466703_373673 3300042636 Bacteria 6950
33 Ga0466709_314545 3300042648 Bacteria 211401
34 Ga0466711_167904 3300042615 Bacteria 18151
35 Ga0123356_10371216 3300010049 Bacteria 1561
36 Ga0160455_100182 3300012837 Bacteria 62069
37 Ga0466703_089159 3300042636 Bacteria 5119
38 JGI24695J34938_10031702 3300002450 Bacteria 2448
39 JGI24696J40584_12950836 3300002834 Bacteria 2185
40 Ga0103267_1000280 3300007190 Bacteria 18463
41 Ga0466697_173942 3300042611 Bacteria 1559
42 Ga0466723_071083 3300042618 Bacteria 3725
43 Ga0466726_377792 3300042619 Bacteria 6510
44 Ga0466701_100426 3300042598 Bacteria 4734
45 Ga0466706_043649 3300042599 Bacteria 38829
46 Ga0466713_098049 3300042602 Bacteria 14184
47 Ga0123356_10624370 3300010049 Bacteria 1244
48 Ga0123353_10000067 3300010167 Bacteria 114305
49 Ga0123353_10002765 3300010167 Bacteria 21906
50 Ga0123353_10021165 3300010167 Bacteria 9750
51 Ga0123353_10056610 3300010167 Bacteria 6276
52 Ga0123353_10170379 3300010167 Bacteria 3457
53 Ga0123353_10424779 3300010167 Bacteria 1968
54 Ga0160433_100059 3300012846 Bacteria 121476
55 Ga0466694_189182 3300042594 Bacteria 3864
56 Ga0466694_198766 3300042594 Unclassified 1129
57 Ga0466694_272505 3300042594 Bacteria 4620
58 Ga0466695_313410 3300042595 Bacteria 2191
59 Ga0466701_014088 3300042598 Bacteria 4688
60 Ga0466729_252861 3300042621 Bacteria 9360
61 Ga0466735_036073 3300042624 Bacteria 2407
62 Ga0466704_078687 3300042643 Unclassified 2528
63 IMNBL1DRAFT_c0036023 3300000062 Bacteria 1735
64 JGI24702J35022_10034360 3300002462 Bacteria 2711
65 JGI24696J40584_12958447 3300002834 Unclassified 4150
66 Ga0072941_1109834 3300005201 Bacteria 4512
67 Ga0123357_10000098 3300009784 Bacteria 71462
68 Ga0466732_043598 3300042656 Bacteria 56649
69 Ga0466706_014102 3300042599 Bacteria 29927
70 Ga0466713_057198 3300042602 Bacteria 57543
71 Ga0466719_559118 3300042606 Bacteria 12880
72 Ga0123353_10000161 3300010167 Bacteria 85161
73 Ga0123353_10001361 3300010167 Bacteria 29989
74 Ga0123353_10001374 3300010167 Bacteria 29814
75 Ga0123353_10336080 3300010167 Bacteria 2284
76 Ga0466699_366066 3300042597 Bacteria 1846
77 IMNBGM34_c000995 3300000036 Bacteria 5883
78 Ga0072940_1196387 3300005200 Bacteria 1549
79 Ga0103267_1000104 3300007190 Bacteria 52998
80 Ga0466715_628336 3300042616 Bacteria 2778
81 Ga0466707_420205 3300042601 Bacteria 47782
82 Ga0466714_071310 3300042603 Bacteria 4542
83 Ga0123355_10315451 3300009826 Bacteria 2113
84 Ga0123356_10000164 3300010049 Bacteria 74678
85 Ga0123353_10644599 3300010167 Unclassified 1501
86 Ga0123354_10362259 3300010882 Bacteria 1277
87 Ga0160465_100037 3300012803 Bacteria 178841
88 Ga0415639_010542 3300038395 Bacteria 2603
89 Ga0466657_024645 3300042582 Bacteria 3482
90 Ga0466690_368796 3300042590 Unclassified 2158
91 Ga0466694_040622 3300042594 Bacteria 1276
92 Ga0466731_105324 3300042622 Bacteria 1097
93 Ga0466735_200330 3300042624 Bacteria 28469
94 Ga0466708_175044 3300042652 Unclassified 15570
95 IMNBL1DRAFT_c0007731 3300000062 Bacteria 5593
96 JGI24702J35022_10012707 3300002462 Bacteria 4674
97 Ga0068305_10647953 3300005083 Bacteria 5498
98 Ga0466733_163001 3300042659 Bacteria 4927
99 Ga0466710_081066 3300042613 Bacteria 1727
100 Ga0123355_10000074 3300009826 Bacteria 105380
101 Ga0123353_10000321 3300010167 Bacteria 59258
102 Ga0123353_10338725 3300010167 Bacteria 2273
103 Ga0466657_300253 3300042582 Bacteria 17191
104 Ga0466691_009650 3300042593 Bacteria 16342
105 Ga0466695_398450 3300042595 Bacteria 8670
106 Ga0466696_325226 3300042596 Bacteria 8602
107 Ga0466699_230827 3300042597 Bacteria 1019
108 Ga0466704_515351 3300042643 Bacteria 2113
109 JGI24695J34938_10047181 3300002450 Bacteria 1903
110 JGI24696J40584_12961690 3300002834 Unclassified 37521
111 Ga0466700_419182 3300042600 Bacteria 3506
112 Ga0466714_010844 3300042603 Bacteria 29148
113 Ga0123353_10009223 3300010167 Bacteria 13581
114 Ga0123353_10110088 3300010167 Bacteria 4438
115 Ga0123354_10001519 3300010882 Bacteria 28402
116 Ga0415639_007438 3300038395 Unclassified 4119
117 Ga0466656_088036 3300042550 Bacteria 15550
118 Ga0466657_240938 3300042582 Bacteria 4051
119 Ga0466693_311496 3300042592 Bacteria 1417
120 Ga0466696_344568 3300042596 Unclassified 3562

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_040622 Ga0466694_040622_26_838 270
2 3300042604 Ga0466717_251260 Ga0466717_251260_574_1503 277
3 3300042597 Ga0466699_366066 Ga0466699_366066_239_1132 280
4 3300010049 Ga0123356_10624370 Ga0123356_106243701 282
5 3300007192 Ga0103268_1001855 Ga0103268_10018554 283
6 3300012803 Ga0160465_100037 Ga0160465_100037133 285
7 3300042596 Ga0466696_325226 Ga0466696_325226_22_888 288
8 3300000036 IMNBGM34_c000995 IMNBGM34_0009953 290
9 3300012837 Ga0160455_100182 Ga0160455_10018214 292
10 3300042582 Ga0466657_240938 Ga0466657_240938_997_1920 292
11 3300012846 Ga0160433_100059 Ga0160433_10005975 293
12 3300042594 Ga0466694_198766 Ga0466694_198766_16_897 293
13 3300002834 JGI24696J40584_12950836 JGI24696J40584_129508363 294
14 3300042595 Ga0466695_067706 Ga0466695_067706_62_949 295
15 3300007190 Ga0103267_1000104 Ga0103267_100010435 296
16 3300009826 Ga0123355_10438499 Ga0123355_104384992 296
17 3300010049 Ga0123356_10000164 Ga0123356_1000016436 296
18 3300005200 Ga0072940_1486056 Ga0072940_14860561 297
19 3300042582 Ga0466657_024645 Ga0466657_024645_1008_1901 297
20 3300042595 Ga0466695_313410 Ga0466695_313410_775_1686 297
21 3300042550 Ga0466656_088036 Ga0466656_088036_14522_15421 299
22 3300042622 Ga0466731_105324 Ga0466731_105324_83_982 299
23 iso_pr_bacteria 2864836148 2864839291 299
24 3300042609 Ga0466722_135473 Ga0466722_135473_1515_2417 300
25 iso_pr_bacteria 2820786992 2820787871 300
26 3300009826 Ga0123355_10158466 Ga0123355_101584663 301
27 3300042610 Ga0466698_267174 Ga0466698_267174_187_1092 301
28 iso_pr_bacteria 2820183396 2820184025 301
29 3300009826 Ga0123355_10315451 Ga0123355_103154513 302
30 3300010167 Ga0123353_10000161 Ga0123353_1000016127 302
31 3300010167 Ga0123353_10002765 Ga0123353_100027655 302
32 3300010167 Ga0123353_10009223 Ga0123353_100092233 302
33 3300038395 Ga0415639_007438 Ga0415639_007438_1635_2543 302
34 3300002450 JGI24695J34938_10047181 JGI24695J34938_100471812 303
35 3300010167 Ga0123353_10021165 Ga0123353_100211653 303
36 3300010167 Ga0123353_10580715 Ga0123353_105807152 304
37 3300042550 Ga0466656_313302 Ga0466656_313302_1583_2497 304
38 iso_pr_bacteria 2820765201 2820766755 304
39 3300010167 Ga0123353_10110088 Ga0123353_101100885 305
40 3300042624 Ga0466735_036073 Ga0466735_036073_819_1769 305
41 iso_pr_bacteria 2820788205 2820788789 305
42 3300002450 JGI24695J34938_10031702 JGI24695J34938_100317022 306
43 3300005083 Ga0068305_10647953 Ga0068305_106479533 306
44 3300009826 Ga0123355_10000308 Ga0123355_1000030828 306
45 3300010167 Ga0123353_10424779 Ga0123353_104247792 306
46 3300042582 Ga0466657_300253 Ga0466657_300253_3994_4914 306
47 3300042603 Ga0466714_010844 Ga0466714_010844_195_1115 306
48 3300042595 Ga0466695_398450 Ga0466695_398450_7040_7963 307
49 3300042600 Ga0466700_419182 Ga0466700_419182_1810_2733 307
50 3300007190 Ga0103267_1000039 Ga0103267_10000391 308
51 3300007190 Ga0103267_1000280 Ga0103267_100028010 308
52 3300042596 Ga0466696_203255 Ga0466696_203255_909_1835 308
53 3300042599 Ga0466706_143471 Ga0466706_143471_3751_4677 308
54 3300042603 Ga0466714_071310 Ga0466714_071310_1919_2845 308
55 3300042624 Ga0466735_200330 Ga0466735_200330_199_1125 308
56 3300042648 Ga0466709_314545 Ga0466709_314545_111399_112325 308
57 3300042656 Ga0466732_043598 Ga0466732_043598_17464_18390 308
58 3300042659 Ga0466733_163001 Ga0466733_163001_1239_2165 308
59 iso_pr_bacteria 2820789850 2820791699 308
60 iso_pr_bacteria 2820797595 2820798076 308
61 3300002834 JGI24696J40584_12960630 JGI24696J40584_129606305 309
62 3300002834 JGI24696J40584_12961690 JGI24696J40584_129616905 309
63 3300010167 Ga0123353_10001374 Ga0123353_100013748 309
64 3300010882 Ga0123354_10001519 Ga0123354_1000151921 309
65 3300038395 Ga0415639_010542 Ga0415639_010542_147_1076 309
66 3300042592 Ga0466693_366921 Ga0466693_366921_663_1592 309
67 3300042594 Ga0466694_189182 Ga0466694_189182_2679_3608 309
68 3300042596 Ga0466696_378508 Ga0466696_378508_3146_4075 309
69 3300042597 Ga0466699_189306 Ga0466699_189306_299_1228 309
70 3300042598 Ga0466701_014088 Ga0466701_014088_1164_2093 309
71 3300042599 Ga0466706_043649 Ga0466706_043649_33558_34487 309
72 3300042602 Ga0466713_057198 Ga0466713_057198_23221_24150 309
73 iso_pr_bacteria 2820744581 2820745240 309
74 iso_pr_bacteria 2882250448 2882251702 309
75 3300002462 JGI24702J35022_10012707 JGI24702J35022_100127072 310
76 3300002834 JGI24696J40584_12958447 JGI24696J40584_129584473 310
77 3300005200 Ga0072940_1196387 Ga0072940_11963872 310
78 3300010049 Ga0123356_10371216 Ga0123356_103712161 310
79 3300010167 Ga0123353_10170379 Ga0123353_101703794 310
80 3300010882 Ga0123354_10292605 Ga0123354_102926052 310
81 iso_pr_bacteria 2811995047 2812946635 310
82 3300042590 Ga0466690_368796 Ga0466690_368796_64_999 311
83 3300042592 Ga0466693_311496 Ga0466693_311496_80_1015 311
84 3300042593 Ga0466691_009650 Ga0466691_009650_2806_3741 311
85 3300042594 Ga0466694_272505 Ga0466694_272505_528_1463 311
86 3300042597 Ga0466699_230827 Ga0466699_230827_33_968 311
87 3300042598 Ga0466701_100426 Ga0466701_100426_2979_3914 311
88 3300042599 Ga0466706_058902 Ga0466706_058902_29996_30931 311
89 3300042602 Ga0466713_098049 Ga0466713_098049_2511_3446 311
90 3300042602 Ga0466713_105299 Ga0466713_105299_16138_17073 311
91 3300042612 Ga0466705_101462 Ga0466705_101462_6458_7393 311
92 3300042613 Ga0466710_130006 Ga0466710_130006_588_1523 311
93 3300042615 Ga0466711_167904 Ga0466711_167904_15609_16544 311
94 3300042615 Ga0466711_283396 Ga0466711_283396_6798_7733 311
95 3300042616 Ga0466715_628336 Ga0466715_628336_110_1045 311
96 3300042618 Ga0466723_071083 Ga0466723_071083_832_1767 311
97 3300042619 Ga0466726_377792 Ga0466726_377792_5344_6279 311
98 3300042621 Ga0466729_252861 Ga0466729_252861_4424_5359 311
99 3300042643 Ga0466704_078687 Ga0466704_078687_665_1600 311
100 3300042648 Ga0466709_324730 Ga0466709_324730_6333_7268 311
101 3300042652 Ga0466708_175044 Ga0466708_175044_7572_8507 311
102 3300042659 Ga0466733_065509 Ga0466733_065509_2602_3537 311
103 3300000062 IMNBL1DRAFT_c0007731 IMNBL1DRAFT_00077313 312
104 3300000062 IMNBL1DRAFT_c0036023 IMNBL1DRAFT_00360232 312
105 3300002462 JGI24702J35022_10034360 JGI24702J35022_100343604 312
106 3300002504 JGI24705J35276_12181310 JGI24705J35276_121813102 312
107 3300005201 Ga0072941_1109834 Ga0072941_11098342 312
108 3300010167 Ga0123353_10336080 Ga0123353_103360803 312
109 3300010167 Ga0123353_10338725 Ga0123353_103387252 312
110 3300010167 Ga0123353_10644599 Ga0123353_106445992 312
111 3300010882 Ga0123354_10362259 Ga0123354_103622592 312
112 3300042613 Ga0466710_081066 Ga0466710_081066_411_1349 312
113 3300010167 Ga0123353_10001361 Ga0123353_100013614 314
114 3300042599 Ga0466706_014102 Ga0466706_014102_7212_8156 314
115 3300042601 Ga0466707_420205 Ga0466707_420205_45166_46110 314
116 iso_pr_bacteria 2820183396 2820184283 314
117 iso_pr_bacteria 2820189034 2820189181 314
118 iso_pr_bacteria 2820770630 2820771103 314
119 3300009784 Ga0123357_10000098 Ga0123357_100000985 315
120 3300010167 Ga0123353_10000067 Ga0123353_10000067102 315
121 3300010167 Ga0123353_10000321 Ga0123353_1000032132 315
122 3300010167 Ga0123353_10056610 Ga0123353_100566106 315
123 3300042596 Ga0466696_344568 Ga0466696_344568_1328_2275 315
124 3300042596 Ga0466696_407626 Ga0466696_407626_111_1058 315
125 3300042611 Ga0466697_173942 Ga0466697_173942_442_1389 315
126 3300042636 Ga0466703_089159 Ga0466703_089159_401_1348 315
127 iso_pr_bacteria 2820750388 2820750423 315
128 iso_pr_bacteria 8065497608 8065497644 315
129 iso_pr_bacteria 8065497608 8065501927 315
130 3300010167 Ga0123353_10534042 Ga0123353_105340423 316
131 iso_pr_bacteria 2820785563 2820785883 316
132 3300009826 Ga0123355_10000074 Ga0123355_1000007442 317
133 3300042602 Ga0466713_076070 Ga0466713_076070_10614_11567 317
134 3300042643 Ga0466704_515351 Ga0466704_515351_125_1219 317
135 3300042593 Ga0466691_013866 Ga0466691_013866_2093_3049 318
136 3300042606 Ga0466719_559118 Ga0466719_559118_9632_10603 323
137 3300042636 Ga0466703_373673 Ga0466703_373673_4573_5580 335

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01882 DUF58 Protein of unknown function DUF58 66 156 0.95
PF13519 VWA_2 von Willebrand factor type A domain 109 222 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.