Protein Family IF09284
Metagenome
Isolate
114
Members
48
Samples
112
Scaffolds
100.23
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_367008|Ga0466703_367008_24964_25314
- Length
- 116 aa
- Sequence
- MKNSTIVQFFYICGMNMKENDCKIRNYSAILKEKYGAYGTPERAKFDEEAYAFYTSQILIEARKNAKLTQKELAERIGVGTSYISRIEKGVTIPSVATFYRIVSALGRSVELLPAT
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.4%
Kalotermitidae
25.5%
Unclassified
10.6%
Termopsidae
2.1%
Rhinotermitidae
2.1%
Passalidae
2.1%
Taxonomy
Archaea
1
Bacteria
96
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 2 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 3 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 4 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 5 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 6 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 7 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 42 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_390286 | 3300042656 | Bacteria | 1059 |
| 2 | Ga0466733_182269 | 3300042659 | Bacteria | 1420 |
| 3 | Ga0123356_12300444 | 3300010049 | Bacteria | 674 |
| 4 | Ga0123353_10260872 | 3300010167 | Bacteria | 2676 |
| 5 | Ga0466656_158218 | 3300042550 | Bacteria | 1251 |
| 6 | Ga0466690_269123 | 3300042590 | Bacteria | 14586 |
| 7 | Ga0466735_095024 | 3300042624 | Bacteria | 1990 |
| 8 | Ga0466708_113718 | 3300042652 | Bacteria | 3548 |
| 9 | Ga0466725_454367 | 3300042654 | Bacteria | 1098 |
| 10 | Ga0466700_274743 | 3300042600 | Bacteria | 43717 |
| 11 | Ga0466716_522682 | 3300042605 | Bacteria | 3975 |
| 12 | Ga0466719_047267 | 3300042606 | Unclassified | 6201 |
| 13 | Ga0466705_417380 | 3300042612 | Bacteria | 4263 |
| 14 | Ga0466710_094910 | 3300042613 | Bacteria | 1267 |
| 15 | Ga0466712_240915 | 3300042614 | Bacteria | 4033 |
| 16 | JGI24698J34947_10151978 | 3300002449 | Bacteria | 960 |
| 17 | JGI24702J35022_10115963 | 3300002462 | Unclassified | 1476 |
| 18 | Ga0123356_10133595 | 3300010049 | Bacteria | 2435 |
| 19 | Ga0123353_11942785 | 3300010167 | Bacteria | 724 |
| 20 | Ga0123354_10574485 | 3300010882 | Unclassified | 838 |
| 21 | Ga0466656_199302 | 3300042550 | Bacteria | 1789 |
| 22 | Ga0466693_053493 | 3300042592 | Unclassified | 1269 |
| 23 | Ga0466735_048019 | 3300042624 | Bacteria | 2321 |
| 24 | Ga0466701_070837 | 3300042598 | Bacteria | 2269 |
| 25 | Ga0466707_249099 | 3300042601 | Bacteria | 1169 |
| 26 | Ga0466713_019970 | 3300042602 | Bacteria | 1704 |
| 27 | Ga0466714_017961 | 3300042603 | Bacteria | 6192 |
| 28 | Ga0466717_231158 | 3300042604 | Unclassified | 1679 |
| 29 | Ga0466716_324101 | 3300042605 | Bacteria | 13928 |
| 30 | Ga0466721_333741 | 3300042608 | Bacteria | 2731 |
| 31 | Ga0466698_312268 | 3300042610 | Bacteria | 3347 |
| 32 | Ga0466697_008780 | 3300042611 | Bacteria | 1077 |
| 33 | Ga0466711_366670 | 3300042615 | Bacteria | 1286 |
| 34 | Ga0466705_067267 | 3300042612 | Bacteria | 1631 |
| 35 | Ga0466733_025452 | 3300042659 | Bacteria | 2249 |
| 36 | JGI24698J34947_10179784 | 3300002449 | Bacteria | 847 |
| 37 | JGI24705J35276_12130273 | 3300002504 | Unclassified | 1102 |
| 38 | JGI24696J40584_12553910 | 3300002834 | Bacteria | 628 |
| 39 | Ga0068305_10013211 | 3300005083 | Unclassified | 1179 |
| 40 | Ga0123357_10416352 | 3300009784 | Bacteria | 1204 |
| 41 | Ga0123354_10071571 | 3300010882 | Bacteria | 5002 |
| 42 | Ga0123354_10444365 | 3300010882 | Bacteria | 1056 |
| 43 | Ga0466690_284631 | 3300042590 | Bacteria | 2618 |
| 44 | Ga0466703_175003 | 3300042636 | Bacteria | 10348 |
| 45 | Ga0466719_322452 | 3300042606 | Bacteria | 1445 |
| 46 | Ga0466712_199590 | 3300042614 | Unclassified | 1604 |
| 47 | Ga0466711_245761 | 3300042615 | Bacteria | 2967 |
| 48 | Ga0466733_054567 | 3300042659 | Bacteria | 5022 |
| 49 | Ga0123357_10003694 | 3300009784 | Bacteria | 17666 |
| 50 | Ga0123356_11158251 | 3300010049 | Bacteria | 940 |
| 51 | Ga0123353_10723429 | 3300010167 | Bacteria | 1392 |
| 52 | Ga0123353_11808838 | 3300010167 | Bacteria | 759 |
| 53 | Ga0123354_10314508 | 3300010882 | Bacteria | 1456 |
| 54 | Ga0123354_10965964 | 3300010882 | Unclassified | 551 |
| 55 | Ga0466691_082219 | 3300042593 | Bacteria | 62191 |
| 56 | Ga0466694_237098 | 3300042594 | Bacteria | 1182 |
| 57 | Ga0466735_024244 | 3300042624 | Bacteria | 1142 |
| 58 | Ga0466735_205903 | 3300042624 | Bacteria | 1131 |
| 59 | Ga0466707_384310 | 3300042601 | Bacteria | 9071 |
| 60 | 2227294666 | 2225789004 | Bacteria | 6680 |
| 61 | JGI24702J35022_10392983 | 3300002462 | Bacteria | 836 |
| 62 | JGI24705J35276_11621272 | 3300002504 | Bacteria | 599 |
| 63 | Ga0123356_10594833 | 3300010049 | Bacteria | 1270 |
| 64 | Ga0123356_12351966 | 3300010049 | Bacteria | 666 |
| 65 | Ga0123356_13375309 | 3300010049 | Bacteria | 554 |
| 66 | Ga0123353_10667248 | 3300010167 | Bacteria | 1468 |
| 67 | Ga0466731_334428 | 3300042622 | Bacteria | 1769 |
| 68 | Ga0466703_214298 | 3300042636 | Bacteria | 3691 |
| 69 | Ga0466704_172512 | 3300042643 | Bacteria | 5223 |
| 70 | Ga0466707_120083 | 3300042601 | Bacteria | 1599 |
| 71 | Ga0466707_141366 | 3300042601 | Bacteria | 10709 |
| 72 | Ga0466715_628178 | 3300042616 | Archaea | 1200 |
| 73 | Ga0466728_328134 | 3300042620 | Bacteria | 1166 |
| 74 | 2227670459 | 2225789004 | Unclassified | 1900 |
| 75 | JGI24702J35022_10057958 | 3300002462 | Unclassified | 2068 |
| 76 | JGI24699J35502_11134121 | 3300002509 | Bacteria | 33827 |
| 77 | Ga0123357_10225031 | 3300009784 | Unclassified | 2071 |
| 78 | Ga0123356_10104321 | 3300010049 | Bacteria | 2725 |
| 79 | Ga0123356_12167835 | 3300010049 | Unclassified | 694 |
| 80 | Ga0123353_11784989 | 3300010167 | Unclassified | 765 |
| 81 | Ga0123353_12456597 | 3300010167 | Bacteria | 621 |
| 82 | Ga0123354_10001134 | 3300010882 | Bacteria | 31081 |
| 83 | Ga0466734_144471 | 3300042623 | Bacteria | 6450 |
| 84 | Ga0466703_123659 | 3300042636 | Bacteria | 1062 |
| 85 | Ga0466704_154422 | 3300042643 | Bacteria | 1287 |
| 86 | Ga0466707_154639 | 3300042601 | Bacteria | 2083 |
| 87 | 2227434423 | 2225789004 | Bacteria | 1032 |
| 88 | JGI24702J35022_10031481 | 3300002462 | Bacteria | 2843 |
| 89 | Ga0068305_10051138 | 3300005083 | Bacteria | 3188 |
| 90 | Ga0072941_1083339 | 3300005201 | Bacteria | 15001 |
| 91 | Ga0123353_12989197 | 3300010167 | Bacteria | 548 |
| 92 | Ga0123354_10298622 | 3300010882 | Bacteria | 1528 |
| 93 | Ga0466693_047398 | 3300042592 | Bacteria | 2923 |
| 94 | Ga0466699_124524 | 3300042597 | Bacteria | 1524 |
| 95 | Ga0466735_205337 | 3300042624 | Unclassified | 1212 |
| 96 | Ga0466704_394483 | 3300042643 | Bacteria | 19482 |
| 97 | Ga0466716_496647 | 3300042605 | Bacteria | 2710 |
| 98 | Ga0466698_292832 | 3300042610 | Bacteria | 1039 |
| 99 | Ga0466723_034154 | 3300042618 | Bacteria | 1129 |
| 100 | Ga0123357_10225661 | 3300009784 | Unclassified | 2067 |
| 101 | Ga0123356_10973390 | 3300010049 | Unclassified | 1019 |
| 102 | Ga0123353_10078533 | 3300010167 | Bacteria | 5304 |
| 103 | Ga0123353_10378119 | 3300010167 | Bacteria | 2120 |
| 104 | Ga0123353_12700540 | 3300010167 | Bacteria | 585 |
| 105 | Ga0123354_10441591 | 3300010882 | Bacteria | 1062 |
| 106 | Ga0466656_270660 | 3300042550 | Bacteria | 1083 |
| 107 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 108 | Ga0466700_293872 | 3300042600 | Bacteria | 6393 |
| 109 | Ga0466716_142105 | 3300042605 | Bacteria | 1242 |
| 110 | Ga0466716_326483 | 3300042605 | Bacteria | 5146 |
| 111 | Ga0466722_060922 | 3300042609 | Bacteria | 1247 |
| 112 | Ga0466722_143556 | 3300042609 | Bacteria | 14188 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_082219 | Ga0466691_082219_58349_58630 | 93 |
| 2 | 3300042609 | Ga0466722_060922 | Ga0466722_060922_760_1041 | 93 |
| 3 | 3300042609 | Ga0466722_143556 | Ga0466722_143556_3818_4099 | 93 |
| 4 | 3300042592 | Ga0466693_053493 | Ga0466693_053493_416_700 | 94 |
| 5 | 3300042605 | Ga0466716_324101 | Ga0466716_324101_12219_12503 | 94 |
| 6 | 3300042605 | Ga0466716_522682 | Ga0466716_522682_1609_1893 | 94 |
| 7 | 3300042611 | Ga0466697_008780 | Ga0466697_008780_476_760 | 94 |
| 8 | 3300042618 | Ga0466723_034154 | Ga0466723_034154_456_740 | 94 |
| 9 | 3300042643 | Ga0466704_394483 | Ga0466704_394483_7207_7491 | 94 |
| 10 | 3300042652 | Ga0466708_113718 | Ga0466708_113718_2531_2815 | 94 |
| 11 | 3300042654 | Ga0466725_454367 | Ga0466725_454367_281_565 | 94 |
| 12 | 3300042656 | Ga0466732_390286 | Ga0466732_390286_409_693 | 94 |
| 13 | 3300042659 | Ga0466733_025452 | Ga0466733_025452_713_997 | 94 |
| 14 | 3300010167 | Ga0123353_11808838 | Ga0123353_118088381 | 95 |
| 15 | 3300010882 | Ga0123354_10314508 | Ga0123354_103145082 | 95 |
| 16 | 3300042601 | Ga0466707_154639 | Ga0466707_154639_1658_1951 | 97 |
| 17 | 3300042590 | Ga0466690_284631 | Ga0466690_284631_28_324 | 98 |
| 18 | 3300009784 | Ga0123357_10225031 | Ga0123357_102250313 | 99 |
| 19 | 3300009784 | Ga0123357_10416352 | Ga0123357_104163521 | 99 |
| 20 | 3300042598 | Ga0466701_070837 | Ga0466701_070837_811_1110 | 99 |
| 21 | 3300042601 | Ga0466707_120083 | Ga0466707_120083_43_342 | 99 |
| 22 | 3300042601 | Ga0466707_141366 | Ga0466707_141366_10265_10564 | 99 |
| 23 | 3300042601 | Ga0466707_249099 | Ga0466707_249099_810_1109 | 99 |
| 24 | 3300042601 | Ga0466707_384310 | Ga0466707_384310_8628_8927 | 99 |
| 25 | 3300042605 | Ga0466716_142105 | Ga0466716_142105_527_826 | 99 |
| 26 | 3300042605 | Ga0466716_326483 | Ga0466716_326483_548_847 | 99 |
| 27 | 3300042605 | Ga0466716_496647 | Ga0466716_496647_477_776 | 99 |
| 28 | 3300042606 | Ga0466719_047267 | Ga0466719_047267_2525_2824 | 99 |
| 29 | 3300042606 | Ga0466719_322452 | Ga0466719_322452_571_870 | 99 |
| 30 | 3300042612 | Ga0466705_067267 | Ga0466705_067267_1055_1354 | 99 |
| 31 | 3300042614 | Ga0466712_240915 | Ga0466712_240915_2838_3137 | 99 |
| 32 | 3300042615 | Ga0466711_366670 | Ga0466711_366670_772_1071 | 99 |
| 33 | 3300042616 | Ga0466715_628178 | Ga0466715_628178_632_931 | 99 |
| 34 | 3300042620 | Ga0466728_328134 | Ga0466728_328134_183_482 | 99 |
| 35 | 3300042624 | Ga0466735_024244 | Ga0466735_024244_672_971 | 99 |
| 36 | 3300042624 | Ga0466735_095024 | Ga0466735_095024_360_659 | 99 |
| 37 | 3300042624 | Ga0466735_205337 | Ga0466735_205337_717_1016 | 99 |
| 38 | 3300042643 | Ga0466704_154422 | Ga0466704_154422_437_736 | 99 |
| 39 | 3300042643 | Ga0466704_172512 | Ga0466704_172512_3038_3337 | 99 |
| 40 | 3300042659 | Ga0466733_054567 | Ga0466733_054567_630_929 | 99 |
| 41 | 2225789004 | 2227294666 | 2227745101 | 100 |
| 42 | 2225789004 | 2227434423 | 2227873570 | 100 |
| 43 | 2225789004 | 2227670459 | 2228275534 | 100 |
| 44 | 3300002449 | JGI24698J34947_10151978 | JGI24698J34947_101519782 | 100 |
| 45 | 3300002449 | JGI24698J34947_10179784 | JGI24698J34947_101797842 | 100 |
| 46 | 3300002462 | JGI24702J35022_10057958 | JGI24702J35022_100579583 | 100 |
| 47 | 3300005201 | Ga0072941_1083339 | Ga0072941_10833394 | 100 |
| 48 | 3300010167 | Ga0123353_10378119 | Ga0123353_103781192 | 100 |
| 49 | 3300042550 | Ga0466656_158218 | Ga0466656_158218_12_314 | 100 |
| 50 | 3300042550 | Ga0466656_199302 | Ga0466656_199302_1282_1584 | 100 |
| 51 | 3300042550 | Ga0466656_270660 | Ga0466656_270660_642_944 | 100 |
| 52 | 3300042594 | Ga0466694_237098 | Ga0466694_237098_75_377 | 100 |
| 53 | 3300042597 | Ga0466699_124524 | Ga0466699_124524_156_458 | 100 |
| 54 | 3300042600 | Ga0466700_293872 | Ga0466700_293872_4871_5173 | 100 |
| 55 | 3300042603 | Ga0466714_017961 | Ga0466714_017961_1254_1556 | 100 |
| 56 | 3300042604 | Ga0466717_231158 | Ga0466717_231158_357_659 | 100 |
| 57 | 3300042608 | Ga0466721_333741 | Ga0466721_333741_1509_1811 | 100 |
| 58 | 3300042612 | Ga0466705_417380 | Ga0466705_417380_3399_3701 | 100 |
| 59 | 3300042613 | Ga0466710_094910 | Ga0466710_094910_878_1180 | 100 |
| 60 | 3300042614 | Ga0466712_199590 | Ga0466712_199590_704_1006 | 100 |
| 61 | 3300042615 | Ga0466711_245761 | Ga0466711_245761_2160_2462 | 100 |
| 62 | 3300042624 | Ga0466735_048019 | Ga0466735_048019_159_461 | 100 |
| 63 | 3300042636 | Ga0466703_214298 | Ga0466703_214298_410_712 | 100 |
| 64 | 3300042659 | Ga0466733_182269 | Ga0466733_182269_240_542 | 100 |
| 65 | iso_pr_bacteria | 2820757377 | 2820758811 | 100 |
| 66 | iso_pr_bacteria | 2820765201 | 2820767143 | 100 |
| 67 | 3300002462 | JGI24702J35022_10031481 | JGI24702J35022_100314811 | 101 |
| 68 | 3300002504 | JGI24705J35276_11621272 | JGI24705J35276_116212721 | 101 |
| 69 | 3300002509 | JGI24699J35502_11134121 | JGI24699J35502_1113412126 | 101 |
| 70 | 3300002834 | JGI24696J40584_12553910 | JGI24696J40584_125539102 | 101 |
| 71 | 3300005083 | Ga0068305_10051138 | Ga0068305_100511382 | 101 |
| 72 | 3300009784 | Ga0123357_10003694 | Ga0123357_100036943 | 101 |
| 73 | 3300009784 | Ga0123357_10225661 | Ga0123357_102256613 | 101 |
| 74 | 3300010049 | Ga0123356_10104321 | Ga0123356_101043214 | 101 |
| 75 | 3300010049 | Ga0123356_10133595 | Ga0123356_101335952 | 101 |
| 76 | 3300010049 | Ga0123356_10594833 | Ga0123356_105948333 | 101 |
| 77 | 3300010049 | Ga0123356_10973390 | Ga0123356_109733903 | 101 |
| 78 | 3300010049 | Ga0123356_11158251 | Ga0123356_111582511 | 101 |
| 79 | 3300010049 | Ga0123356_12167835 | Ga0123356_121678352 | 101 |
| 80 | 3300010049 | Ga0123356_12300444 | Ga0123356_123004441 | 101 |
| 81 | 3300010049 | Ga0123356_12351966 | Ga0123356_123519662 | 101 |
| 82 | 3300010167 | Ga0123353_10078533 | Ga0123353_100785331 | 101 |
| 83 | 3300010167 | Ga0123353_10667248 | Ga0123353_106672482 | 101 |
| 84 | 3300010167 | Ga0123353_11942785 | Ga0123353_119427852 | 101 |
| 85 | 3300010167 | Ga0123353_12456597 | Ga0123353_124565972 | 101 |
| 86 | 3300010167 | Ga0123353_12700540 | Ga0123353_127005402 | 101 |
| 87 | 3300010882 | Ga0123354_10001134 | Ga0123354_100011345 | 101 |
| 88 | 3300010882 | Ga0123354_10298622 | Ga0123354_102986223 | 101 |
| 89 | 3300010882 | Ga0123354_10441591 | Ga0123354_104415911 | 101 |
| 90 | 3300010882 | Ga0123354_10444365 | Ga0123354_104443653 | 101 |
| 91 | 3300010882 | Ga0123354_10574485 | Ga0123354_105744852 | 101 |
| 92 | 3300042602 | Ga0466713_019970 | Ga0466713_019970_14_319 | 101 |
| 93 | 3300042610 | Ga0466698_312268 | Ga0466698_312268_2363_2668 | 101 |
| 94 | 3300042624 | Ga0466735_205903 | Ga0466735_205903_272_577 | 101 |
| 95 | 3300005083 | Ga0068305_10013211 | Ga0068305_100132111 | 102 |
| 96 | 3300010049 | Ga0123356_13375309 | Ga0123356_133753092 | 102 |
| 97 | 3300042610 | Ga0466698_292832 | Ga0466698_292832_17_325 | 102 |
| 98 | 3300010167 | Ga0123353_10723429 | Ga0123353_107234293 | 103 |
| 99 | 3300010167 | Ga0123353_12989197 | Ga0123353_129891971 | 103 |
| 100 | 3300010882 | Ga0123354_10965964 | Ga0123354_109659641 | 103 |
| 101 | 3300042590 | Ga0466690_269123 | Ga0466690_269123_12962_13273 | 103 |
| 102 | 3300042592 | Ga0466693_047398 | Ga0466693_047398_2206_2517 | 103 |
| 103 | 3300042623 | Ga0466734_144471 | Ga0466734_144471_6064_6375 | 103 |
| 104 | 3300002504 | JGI24705J35276_12130273 | JGI24705J35276_121302731 | 104 |
| 105 | 3300010167 | Ga0123353_10260872 | Ga0123353_102608721 | 104 |
| 106 | 3300010167 | Ga0123353_11784989 | Ga0123353_117849891 | 104 |
| 107 | 3300010882 | Ga0123354_10071571 | Ga0123354_100715715 | 104 |
| 108 | 3300042636 | Ga0466703_123659 | Ga0466703_123659_374_688 | 104 |
| 109 | 3300042636 | Ga0466703_175003 | Ga0466703_175003_2034_2348 | 104 |
| 110 | 3300002462 | JGI24702J35022_10115963 | JGI24702J35022_101159632 | 105 |
| 111 | 3300002462 | JGI24702J35022_10392983 | JGI24702J35022_103929831 | 105 |
| 112 | 3300042622 | Ga0466731_334428 | Ga0466731_334428_150_500 | 116 |
| 113 | 3300042636 | Ga0466703_367008 | Ga0466703_367008_24964_25314 | 116 |
| 114 | 3300042600 | Ga0466700_274743 | Ga0466700_274743_28153_28536 | 127 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.59 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.