Protein Family IF09283

Metagenome Isolate
115 Members
36 Samples
108 Scaffolds
358.93 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_362209|Ga0466703_362209_50258_51442
Length
394 aa
Sequence
MQKILVGLSGGVDSAVASYLLKKQGFDIIGVMMSIWDNSYPIPKNKDMDACLGPEEDDIESVKKIADFLKIPLHILDCREEYKKVVIENFRNEYKQGRTPNPCVWCNAYIKFGVLPTTAKKHGLAFDKFATGHYANIKFNDSIGMYQLCKAFDETKDQTYFLYRLNQKILSQIVFPLGNLKKEEVRNIAKEIGMPVAQKPDSQDFYCGDYNDILQFPINSGDIIDKNGKVLGKHNGIWNYTIGKRKGLGLSGGTKEPLYVINILAKQNAIVVGPKEDLYSKCLTAVKVSWGSIAAPTQQIQVAVKIRQQHNPAKATITPIDKSSVKVDFQEAQMSITAGQSAVFYKDDVVLGGGIIWAASSCFKSSIGSFSLARSLSSIKTQNFSKCRFKLSQP

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.1%
Unclassified 25.0%
Termitidae 16.7%
Termopsidae 11.1%
Rhinotermitidae 5.6%
Formicidae 2.8%
Hodotermitidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
14 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
18 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
28 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068302_10469606 3300005071 Bacteria 1572
2 Ga0466706_088085 3300042599 Bacteria 25105
3 Ga0466706_203150 3300042599 Bacteria 155769
4 Ga0466700_417079 3300042600 Bacteria 69635
5 Ga0466713_070887 3300042602 Bacteria 102768
6 Ga0466716_085544 3300042605 Bacteria 17970
7 Ga0466726_152310 3300042619 Unclassified 4195
8 Ga0466726_214600 3300042619 Bacteria 58941
9 Ga0466728_003045 3300042620 Bacteria 90142
10 Ga0123354_10000005 3300010882 Bacteria 283385
11 Ga0466729_269183 3300042621 Bacteria 17454
12 Ga0466735_156565 3300042624 Bacteria 2123
13 Ga0466705_151846 3300042612 Bacteria 5436
14 Ga0068305_10000079 3300005083 Bacteria 163717
15 Ga0068305_10006619 3300005083 Unclassified 5338
16 Ga0466706_145545 3300042599 Bacteria 24377
17 Ga0466707_357026 3300042601 Bacteria 7258
18 Ga0466713_090790 3300042602 Bacteria 2956
19 Ga0466714_032663 3300042603 Bacteria 59155
20 Ga0466719_127211 3300042606 Bacteria 279481
21 Ga0466719_204137 3300042606 Bacteria 29278
22 Ga0466722_128210 3300042609 Bacteria 3298
23 Ga0466711_517825 3300042615 Bacteria 192770
24 Ga0466715_328331 3300042616 Bacteria 13295
25 Ga0466723_368798 3300042618 Unclassified 39965
26 Ga0466728_050538 3300042620 Bacteria 48589
27 Ga0123353_10000154 3300010167 Bacteria 86725
28 Ga0466704_118816 3300042643 Unclassified 9817
29 Ga0466704_167270 3300042643 Bacteria 32596
30 Ga0466704_221449 3300042643 Bacteria 5748
31 Ga0466704_252284 3300042643 Bacteria 2844
32 Ga0466709_253029 3300042648 Bacteria 24232
33 Ga0466705_321631 3300042612 Bacteria 270475
34 Ga0466706_029158 3300042599 Bacteria 76030
35 Ga0466707_062878 3300042601 Bacteria 4547
36 Ga0466707_065717 3300042601 Bacteria 13822
37 Ga0466707_130842 3300042601 Bacteria 2757
38 Ga0466696_488094 3300042596 Bacteria 2754
39 Ga0466715_335964 3300042616 Bacteria 23808
40 Ga0466715_543880 3300042616 Bacteria 11794
41 Ga0466705_143986 3300042612 Bacteria 113378
42 Ga0068302_10000023 3300005071 Bacteria 10178
43 Ga0466707_134944 3300042601 Bacteria 69379
44 Ga0466690_055751 3300042590 Bacteria 148091
45 Ga0466690_302598 3300042590 Bacteria 2538
46 Ga0466691_002859 3300042593 Bacteria 11168
47 Ga0466715_469339 3300042616 Bacteria 13839
48 Ga0466723_256173 3300042618 Bacteria 1359
49 Ga0466728_306322 3300042620 Bacteria 70422
50 Ga0123357_10237011 3300009784 Bacteria 1985
51 Ga0466735_120268 3300042624 Bacteria 6406
52 Ga0466735_174625 3300042624 Bacteria 7865
53 Ga0466705_260692 3300042612 Unclassified 4898
54 Ga0068305_10000090 3300005083 Bacteria 152414
55 Ga0466716_165265 3300042605 Bacteria 3559
56 Ga0466719_102704 3300042606 Bacteria 110867
57 Ga0466719_130653 3300042606 Bacteria 158630
58 Ga0466690_105966 3300042590 Bacteria 18205
59 Ga0466690_107088 3300042590 Bacteria 25813
60 Ga0466691_001046 3300042593 Unclassified 6777
61 Ga0466723_086043 3300042618 Bacteria 1456
62 Ga0466726_159837 3300042619 Bacteria 9298
63 Ga0466728_061894 3300042620 Bacteria 95675
64 Ga0466729_133905 3300042621 Bacteria 8185
65 Ga0123357_10004024 3300009784 Bacteria 17105
66 Ga0466735_228412 3300042624 Bacteria 9341
67 Ga0466727_172156 3300042655 Bacteria 156225
68 Ga0466727_253697 3300042655 Bacteria 2268
69 Ga0466727_319284 3300042655 Bacteria 4229
70 Ga0466705_171019 3300042612 Bacteria 78873
71 Ga0466705_358629 3300042612 Bacteria 19876
72 Ga0466707_158829 3300042601 Bacteria 178149
73 Ga0466713_153150 3300042602 Bacteria 5584
74 Ga0466719_459434 3300042606 Bacteria 2600
75 Ga0466711_135417 3300042615 Bacteria 2355
76 Ga0466711_343640 3300042615 Bacteria 4027
77 Ga0466711_372501 3300042615 Bacteria 489210
78 Ga0466715_141325 3300042616 Bacteria 38841
79 Ga0466715_517415 3300042616 Bacteria 23940
80 Ga0466723_086442 3300042618 Unclassified 40541
81 Ga0466729_062234 3300042621 Bacteria 8998
82 Ga0466729_072144 3300042621 Bacteria 3553
83 Ga0123356_10000184 3300010049 Bacteria 71830
84 Ga0466703_362209 3300042636 Bacteria 54490
85 Ga0466704_050703 3300042643 Bacteria 35324
86 Ga0466727_277996 3300042655 Bacteria 60667
87 Ga0466716_190935 3300042605 Bacteria 6960
88 Ga0466690_351395 3300042590 Unclassified 15172
89 Ga0466691_144881 3300042593 Bacteria 142883
90 Ga0466696_161918 3300042596 Unclassified 2813
91 Ga0466711_157498 3300042615 Bacteria 313285
92 Ga0466711_355820 3300042615 Bacteria 54624
93 Ga0466715_127873 3300042616 Bacteria 35795
94 Ga0466715_436492 3300042616 Bacteria 169505
95 Ga0466726_078640 3300042619 Bacteria 41565
96 Ga0466729_291635 3300042621 Bacteria 3111
97 Ga0466703_395188 3300042636 Bacteria 299836
98 Ga0466704_188261 3300042643 Bacteria 31564
99 Ga0466704_224538 3300042643 Unclassified 18811
100 Ga0466707_314480 3300042601 Bacteria 9471
101 Ga0466690_302396 3300042590 Bacteria 3911
102 Ga0466696_337122 3300042596 Bacteria 2318
103 Ga0466711_036444 3300042615 Bacteria 5288
104 Ga0466711_261053 3300042615 Bacteria 39528
105 Ga0466723_271509 3300042618 Unclassified 38778
106 Ga0466735_013888 3300042624 Bacteria 9432
107 Ga0466735_058450 3300042624 Bacteria 31443
108 Ga0466703_110964 3300042636 Bacteria 165564

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_291635 Ga0466729_291635_16_1005 329
2 3300042643 Ga0466704_188261 Ga0466704_188261_8273_9340 334
3 3300042612 Ga0466705_260692 Ga0466705_260692_3773_4852 338
4 3300042621 Ga0466729_062234 Ga0466729_062234_6292_7359 338
5 3300010882 Ga0123354_10000005 Ga0123354_1000000597 339
6 3300042620 Ga0466728_061894 Ga0466728_061894_74249_75319 341
7 3300042655 Ga0466727_319284 Ga0466727_319284_138_1211 341
8 3300042590 Ga0466690_351395 Ga0466690_351395_7329_8417 342
9 3300042616 Ga0466715_469339 Ga0466715_469339_3747_4817 342
10 3300042618 Ga0466723_271509 Ga0466723_271509_35252_36325 342
11 3300009784 Ga0123357_10237011 Ga0123357_102370111 345
12 3300042590 Ga0466690_105966 Ga0466690_105966_14684_15754 345
13 3300042643 Ga0466704_252284 Ga0466704_252284_380_1450 348
14 3300042615 Ga0466711_135417 Ga0466711_135417_461_1534 349
15 3300042615 Ga0466711_157498 Ga0466711_157498_161188_162258 349
16 3300042600 Ga0466700_417079 Ga0466700_417079_64560_65615 351
17 3300042615 Ga0466711_261053 Ga0466711_261053_22748_23806 352
18 3300042601 Ga0466707_357026 Ga0466707_357026_66_1130 354
19 3300042612 Ga0466705_171019 Ga0466705_171019_18419_19528 354
20 3300042619 Ga0466726_152310 Ga0466726_152310_610_1674 354
21 3300042643 Ga0466704_167270 Ga0466704_167270_2476_3585 354
22 iso_pr_bacteria 642555127 642610549 354
23 3300005071 Ga0068302_10469606 Ga0068302_104696062 355
24 3300042593 Ga0466691_001046 Ga0466691_001046_3372_4442 356
25 3300042593 Ga0466691_002859 Ga0466691_002859_3753_4823 356
26 3300042599 Ga0466706_088085 Ga0466706_088085_23685_24755 356
27 3300042601 Ga0466707_065717 Ga0466707_065717_6849_7919 356
28 3300042601 Ga0466707_134944 Ga0466707_134944_1096_2166 356
29 3300042605 Ga0466716_165265 Ga0466716_165265_868_1938 356
30 3300042606 Ga0466719_102704 Ga0466719_102704_102098_103168 356
31 3300042606 Ga0466719_459434 Ga0466719_459434_364_1434 356
32 3300042612 Ga0466705_321631 Ga0466705_321631_233811_234881 356
33 3300042615 Ga0466711_036444 Ga0466711_036444_3679_4749 356
34 3300042618 Ga0466723_086442 Ga0466723_086442_380_1450 356
35 3300042618 Ga0466723_256173 Ga0466723_256173_121_1191 356
36 3300042619 Ga0466726_078640 Ga0466726_078640_7027_8097 356
37 3300042619 Ga0466726_159837 Ga0466726_159837_1670_2740 356
38 3300042619 Ga0466726_214600 Ga0466726_214600_3581_4651 356
39 3300042621 Ga0466729_072144 Ga0466729_072144_1552_2622 356
40 3300042621 Ga0466729_133905 Ga0466729_133905_2067_3170 356
41 3300042624 Ga0466735_156565 Ga0466735_156565_386_1456 356
42 3300042624 Ga0466735_228412 Ga0466735_228412_5438_6508 356
43 3300042643 Ga0466704_050703 Ga0466704_050703_15096_16166 356
44 3300042643 Ga0466704_224538 Ga0466704_224538_16857_17927 356
45 3300042655 Ga0466727_172156 Ga0466727_172156_16823_17893 356
46 3300042655 Ga0466727_253697 Ga0466727_253697_745_1815 356
47 3300042655 Ga0466727_277996 Ga0466727_277996_34813_35883 356
48 iso_pr_bacteria 2754412482 2755215929 356
49 iso_pr_bacteria 2754412483 2755216695 356
50 iso_pr_bacteria 2772190892 2773435541 356
51 iso_pr_bacteria 2772190895 2773441115 356
52 3300005071 Ga0068302_10000023 Ga0068302_100000239 357
53 3300005083 Ga0068305_10000090 Ga0068305_1000009023 357
54 3300010049 Ga0123356_10000184 Ga0123356_1000018439 357
55 3300010167 Ga0123353_10000154 Ga0123353_1000015431 357
56 3300042593 Ga0466691_144881 Ga0466691_144881_115007_116080 357
57 3300042599 Ga0466706_145545 Ga0466706_145545_19911_20984 357
58 3300042601 Ga0466707_130842 Ga0466707_130842_1247_2320 357
59 3300042609 Ga0466722_128210 Ga0466722_128210_1105_2178 357
60 3300042616 Ga0466715_127873 Ga0466715_127873_186_1259 357
61 3300042616 Ga0466715_141325 Ga0466715_141325_35295_36368 357
62 3300042618 Ga0466723_086043 Ga0466723_086043_126_1199 357
63 3300042620 Ga0466728_050538 Ga0466728_050538_7511_8584 357
64 3300042624 Ga0466735_120268 Ga0466735_120268_1710_2783 357
65 3300042599 Ga0466706_203150 Ga0466706_203150_15678_16754 358
66 3300042612 Ga0466705_143986 Ga0466705_143986_74805_75881 358
67 3300042620 Ga0466728_003045 Ga0466728_003045_34773_35849 358
68 3300042621 Ga0466729_269183 Ga0466729_269183_1418_2494 358
69 3300042616 Ga0466715_543880 Ga0466715_543880_3378_4457 359
70 3300042596 Ga0466696_337122 Ga0466696_337122_1015_2097 360
71 3300042601 Ga0466707_314480 Ga0466707_314480_5991_7073 360
72 3300042606 Ga0466719_127211 Ga0466719_127211_233439_234521 360
73 3300042612 Ga0466705_358629 Ga0466705_358629_2475_3557 360
74 3300042615 Ga0466711_372501 Ga0466711_372501_122060_123142 360
75 3300042636 Ga0466703_110964 Ga0466703_110964_102039_103121 360
76 iso_pr_bacteria 642555172 642791121 360
77 3300009784 Ga0123357_10004024 Ga0123357_100040246 361
78 3300042612 Ga0466705_151846 Ga0466705_151846_3042_4127 361
79 3300042616 Ga0466715_436492 Ga0466715_436492_105944_107029 361
80 3300042590 Ga0466690_302598 Ga0466690_302598_1086_2174 362
81 3300042599 Ga0466706_029158 Ga0466706_029158_70444_71532 362
82 3300042602 Ga0466713_070887 Ga0466713_070887_61368_62456 362
83 3300042605 Ga0466716_190935 Ga0466716_190935_5623_6711 362
84 3300042606 Ga0466719_130653 Ga0466719_130653_98278_99366 362
85 3300042606 Ga0466719_204137 Ga0466719_204137_10083_11171 362
86 3300042616 Ga0466715_328331 Ga0466715_328331_5824_6912 362
87 3300042620 Ga0466728_306322 Ga0466728_306322_53898_54986 362
88 3300042648 Ga0466709_253029 Ga0466709_253029_16953_18041 362
89 3300005083 Ga0068305_10000079 Ga0068305_10000079113 363
90 3300005083 Ga0068305_10006619 Ga0068305_100066196 363
91 3300042601 Ga0466707_158829 Ga0466707_158829_8666_9760 364
92 3300042601 Ga0466707_062878 Ga0466707_062878_3046_4143 365
93 3300042605 Ga0466716_085544 Ga0466716_085544_13500_14597 365
94 3300042615 Ga0466711_343640 Ga0466711_343640_428_1525 365
95 3300042615 Ga0466711_355820 Ga0466711_355820_2538_3635 365
96 3300042616 Ga0466715_517415 Ga0466715_517415_7116_8213 365
97 3300042590 Ga0466690_055751 Ga0466690_055751_60997_62097 366
98 3300042596 Ga0466696_161918 Ga0466696_161918_567_1667 366
99 3300042596 Ga0466696_488094 Ga0466696_488094_343_1443 366
100 3300042636 Ga0466703_395188 Ga0466703_395188_118750_119850 366
101 3300042643 Ga0466704_118816 Ga0466704_118816_7092_8192 366
102 3300042602 Ga0466713_153150 Ga0466713_153150_4253_5356 367
103 3300042616 Ga0466715_335964 Ga0466715_335964_4306_5454 367
104 3300042618 Ga0466723_368798 Ga0466723_368798_20202_21350 367
105 3300042615 Ga0466711_517825 Ga0466711_517825_156593_157705 370
106 3300042624 Ga0466735_013888 Ga0466735_013888_6584_7696 370
107 3300042624 Ga0466735_058450 Ga0466735_058450_8212_9342 376
108 3300042624 Ga0466735_174625 Ga0466735_174625_6602_7732 376
109 3300042590 Ga0466690_107088 Ga0466690_107088_2588_3733 381
110 3300042590 Ga0466690_302396 Ga0466690_302396_593_1738 381
111 3300042602 Ga0466713_090790 Ga0466713_090790_1258_2403 381
112 3300042643 Ga0466704_221449 Ga0466704_221449_1822_2967 381
113 3300042603 Ga0466714_032663 Ga0466714_032663_33639_34814 391
114 3300042636 Ga0466703_362209 Ga0466703_362209_50258_51442 394
115 iso_pr_bacteria 2886876212 2886876605 419

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20258 tRNA_Me_trans_C Aminomethyltransferase beta-barrel domain 280 356 0.98
PF20259 tRNA_Me_trans_M tRNA methyl transferase PRC-barrel domain 219 273 0.95
PF03054 tRNA_Me_trans tRNA methyl transferase HUP domain 2 204 0.93

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2der-assembly1.cif.gz_A Cocrystal structure of an RNA sulfuration enzyme MnmA and tRNA-Glu in the initial tRNA binding state 0.919 1 357
2hma-assembly1.cif.gz_A-2 The Crystal Structure of tRNA (5-Methylaminomethyl-2-Thiouridylate)-Methyltransferase TrmU from Streptococcus pneumoniae 0.909 2 364
2deu-assembly2.cif.gz_B Cocrystal structure of an RNA sulfuration enzyme MnmA and tRNA-Glu in the adenylated intermediate state 0.896 1 357
2der-assembly2.cif.gz_B Cocrystal structure of an RNA sulfuration enzyme MnmA and tRNA-Glu in the initial tRNA binding state 0.876 2 356
3h2s-assembly1.cif.gz_B Crystal Structure of the Q03B84 Protein from Lactobacillus casei. Northeast Structural Genomics Consortium Target LcR19. 0.856 2 31
IDDescriptionScoreStartEndSuperfamily
2detA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9536 278 357 2.40.30.10
af_P9WJS5_208_272_2.30.30.280 Mainly Beta;Roll;SH3 type barrels.;Adenine nucleotide alpha hydrolases-like domains 0.9417 216 278 2.30.30.280
af_O13947_324_410_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9382 278 360 2.40.30.10
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9375 1 194 3.40.50.620
af_O75648_300_387_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9347 278 360 2.40.30.10
IDDescriptionScoreStartEndGO Terms
AF-A0A1F6QGF2-F1-model_v4 Uncharacterized/unreviewed 0.9798 2 356
AF-A0A350MSX1-F1-model_v4 Uncharacterized/unreviewed 0.9797 239 360
AF-A0A150MB98-F1-model_v4 tRNA-specific 2-thiouridylase MnmA-like C-terminal domain-containing protein 0.9761 278 357 GO:0005524
GO:0016740
GO:0000049
GO:0002143

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.