Protein Family IF09269

Metagenome Isolate
134 Members
42 Samples
130 Scaffolds
192.67 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_337384|Ga0466703_337384_2079_2747
Length
222 aa
Sequence
LKEQPKGSLGGNELANEGKSAILWAGEFMEPIILASGSLRRQEFFRLLGLPFSIMPPLIDEQIVQGVEPRKMAENFAVMKVKKVVELMKGRIPAWVCGADTIISVDGVIYGKPKDREDAGAMLSRLQGREHEVITAVALKNREGVIDCRSVVSLVSFACLSEQEIEWYLNTGEWQGVAGSYKIQGLASCYITGIKGSPSAVVGLPMNEFYVMLRNNGYPYGG

📊 Sample Types

Isolate 3.0%
Metagenome 97.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.5%
Kalotermitidae 33.3%
Unclassified 14.3%
Termopsidae 9.5%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 1
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
36 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068305_10439010 3300005083 Bacteria 8719
2 Ga0466691_209330 3300042593 Bacteria 7873
3 Ga0466703_181939 3300042636 Bacteria 6903
4 Ga0466703_380717 3300042636 Bacteria 5510
5 Ga0466727_272285 3300042655 Bacteria 1582
6 Ga0466712_163367 3300042614 Bacteria 5458
7 Ga0466711_433757 3300042615 Bacteria 1383
8 Ga0466723_291555 3300042618 Bacteria 20915
9 Ga0466707_049136 3300042601 Bacteria 1015
10 Ga0466719_444651 3300042606 Bacteria 35344
11 JGI24698J34947_10081186 3300002449 Bacteria 1521
12 Ga0123356_10314216 3300010049 Bacteria 1677
13 Ga0466735_009925 3300042624 Unclassified 1429
14 Ga0466735_038334 3300042624 Bacteria 1226
15 Ga0466708_135741 3300042652 Bacteria 11662
16 Ga0466708_279571 3300042652 Bacteria 4449
17 Ga0466727_031941 3300042655 Bacteria 9421
18 Ga0466705_416718 3300042612 Bacteria 2060
19 Ga0466723_299807 3300042618 Bacteria 1038
20 Ga0466728_108495 3300042620 Bacteria 1174
21 Ga0466728_376125 3300042620 Bacteria 1390
22 Ga0466707_356942 3300042601 Bacteria 2015
23 Ga0466716_088441 3300042605 Bacteria 1455
24 Ga0466719_035069 3300042606 Bacteria 14650
25 Ga0466719_123044 3300042606 Bacteria 2006
26 Ga0466719_264379 3300042606 Bacteria 14167
27 Ga0466733_022655 3300042659 Bacteria 1883
28 Ga0466733_089083 3300042659 Bacteria 2926
29 JGI24698J34947_10046265 3300002449 Bacteria 2215
30 JGI24698J34947_10046514 3300002449 Bacteria 2206
31 Ga0123355_10274975 3300009826 Bacteria 2334
32 Ga0123353_10805341 3300010167 Unclassified 1296
33 Ga0466690_210682 3300042590 Bacteria 5057
34 Ga0466691_070315 3300042593 Bacteria 2904
35 Ga0466694_117912 3300042594 Bacteria 1787
36 Ga0466735_205134 3300042624 Bacteria 2305
37 Ga0466716_021401 3300042605 Bacteria 18251
38 Ga0466716_051922 3300042605 Bacteria 10059
39 Ga0466716_161805 3300042605 Bacteria 10935
40 Ga0466733_031282 3300042659 Bacteria 2061
41 JGI24698J34947_10087798 3300002449 Bacteria 1437
42 JGI24695J34938_10002164 3300002450 Bacteria 15336
43 JGI24695J34938_10035616 3300002450 Bacteria 2275
44 Ga0123356_10847773 3300010049 Bacteria 1085
45 Ga0123356_12367891 3300010049 Bacteria 664
46 Ga0466691_226094 3300042593 Bacteria 11447
47 Ga0466695_151841 3300042595 Bacteria 41232
48 Ga0466699_382647 3300042597 Bacteria 4758
49 Ga0466735_235967 3300042624 Bacteria 1555
50 Ga0466703_353040 3300042636 Bacteria 4047
51 Ga0466712_051941 3300042614 Bacteria 37403
52 Ga0466712_162563 3300042614 Bacteria 4208
53 Ga0466715_157935 3300042616 Bacteria 23735
54 Ga0466718_013852 3300042617 Bacteria 2654
55 Ga0466726_187813 3300042619 Bacteria 1995
56 Ga0466728_146625 3300042620 Bacteria 1608
57 Ga0466722_156992 3300042609 Bacteria 2254
58 Ga0068302_10380652 3300005071 Bacteria 941
59 Ga0123356_10003994 3300010049 Bacteria 15325
60 Ga0123356_10018720 3300010049 Bacteria 6573
61 Ga0123356_10154711 3300010049 Bacteria 2282
62 Ga0466691_024704 3300042593 Bacteria 6075
63 Ga0466695_158964 3300042595 Bacteria 5318
64 Ga0466703_132938 3300042636 Bacteria 17353
65 Ga0466704_132165 3300042643 Bacteria 35160
66 Ga0466704_309373 3300042643 Bacteria 19706
67 Ga0466709_194612 3300042648 Bacteria 25927
68 Ga0466708_103796 3300042652 Bacteria 41820
69 Ga0466715_120929 3300042616 Bacteria 51611
70 Ga0466728_103292 3300042620 Bacteria 2577
71 Ga0466728_171577 3300042620 Bacteria 15599
72 Ga0466701_068615 3300042598 Bacteria 1321
73 Ga0466722_191664 3300042609 Bacteria 1344
74 Ga0466733_150505 3300042659 Bacteria 1298
75 Ga0466733_194515 3300042659 Bacteria 1105
76 JGI24698J34947_10000688 3300002449 Bacteria 16494
77 JGI24698J34947_10037305 3300002449 Bacteria 2526
78 Ga0415639_212173 3300038395 Bacteria 2801
79 Ga0466690_353635 3300042590 Bacteria 7026
80 Ga0466691_075760 3300042593 Bacteria 16613
81 Ga0466694_006279 3300042594 Bacteria 29816
82 Ga0466699_309128 3300042597 Archaea 2488
83 Ga0466704_063886 3300042643 Bacteria 26674
84 Ga0466712_037568 3300042614 Bacteria 7893
85 Ga0466715_065478 3300042616 Bacteria 25951
86 Ga0466726_095381 3300042619 Bacteria 5717
87 Ga0466716_260633 3300042605 Bacteria 7818
88 Ga0466705_078278 3300042612 Bacteria 19606
89 Ga0466705_182822 3300042612 Bacteria 4992
90 Ga0466732_114721 3300042656 Bacteria 1523
91 Ga0466733_149052 3300042659 Bacteria 16557
92 JGI24698J34947_10000409 3300002449 Bacteria 19605
93 JGI24698J34947_10009127 3300002449 Bacteria 5443
94 Ga0123354_10041677 3300010882 Bacteria 7092
95 Ga0466691_135382 3300042593 Bacteria 8694
96 Ga0466696_105547 3300042596 Bacteria 6775
97 Ga0466699_237898 3300042597 Bacteria 13519
98 Ga0466699_424683 3300042597 Bacteria 2379
99 Ga0466699_427434 3300042597 Bacteria 1374
100 Ga0466734_075826 3300042623 Bacteria 1906
101 Ga0466735_077974 3300042624 Bacteria 16776
102 Ga0466703_337384 3300042636 Bacteria 14779
103 Ga0466704_046500 3300042643 Bacteria 45746
104 Ga0466709_066227 3300042648 Bacteria 30258
105 Ga0466708_215966 3300042652 Bacteria 9299
106 Ga0466712_173060 3300042614 Bacteria 15755
107 Ga0466711_165879 3300042615 Bacteria 18740
108 Ga0466715_041382 3300042616 Bacteria 5685
109 Ga0466707_094954 3300042601 Bacteria 1291
110 AustNasuHG_c1006399 3300000089 Bacteria 4204
111 JGI24698J34947_10006352 3300002449 Bacteria 6489
112 JGI24698J34947_10022727 3300002449 Unclassified 3359
113 Ga0123356_10079176 3300010049 Bacteria 3104
114 Ga0466690_313579 3300042590 Bacteria 41778
115 Ga0466694_105188 3300042594 Bacteria 1380
116 Ga0466696_093990 3300042596 Bacteria 3526
117 Ga0466735_146783 3300042624 Bacteria 1003
118 Ga0466703_024259 3300042636 Bacteria 18505
119 Ga0466703_159061 3300042636 Bacteria 19395
120 Ga0466704_090508 3300042643 Bacteria 16651
121 Ga0466712_108856 3300042614 Bacteria 1444
122 Ga0466712_274160 3300042614 Bacteria 2112
123 Ga0466718_036173 3300042617 Bacteria 1058
124 Ga0466723_024654 3300042618 Bacteria 62216
125 Ga0466723_036819 3300042618 Bacteria 9481
126 Ga0466723_126542 3300042618 Unclassified 1240
127 Ga0466726_036320 3300042619 Bacteria 3194
128 Ga0466726_184786 3300042619 Bacteria 1125
129 Ga0466728_123097 3300042620 Bacteria 3426
130 Ga0466719_385575 3300042606 Bacteria 2376

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_051941 Ga0466712_051941_2402_2902 166
2 3300042596 Ga0466696_093990 Ga0466696_093990_1251_1757 168
3 3300042601 Ga0466707_049136 Ga0466707_049136_478_984 168
4 3300042601 Ga0466707_356942 Ga0466707_356942_1025_1534 169
5 3300042612 Ga0466705_078278 Ga0466705_078278_11482_11991 169
6 3300042617 Ga0466718_013852 Ga0466718_013852_1766_2275 169
7 3300042617 Ga0466718_036173 Ga0466718_036173_180_689 169
8 3300042659 Ga0466733_194515 Ga0466733_194515_25_534 169
9 3300042624 Ga0466735_009925 Ga0466735_009925_179_691 170
10 3300042636 Ga0466703_353040 Ga0466703_353040_3233_3745 170
11 3300042652 Ga0466708_135741 Ga0466708_135741_10259_10771 170
12 3300042624 Ga0466735_077974 Ga0466735_077974_14551_15069 172
13 3300042614 Ga0466712_108856 Ga0466712_108856_884_1405 173
14 3300042624 Ga0466735_235967 Ga0466735_235967_397_918 173
15 3300042598 Ga0466701_068615 Ga0466701_068615_25_552 175
16 3300042620 Ga0466728_103292 Ga0466728_103292_444_971 175
17 3300042636 Ga0466703_159061 Ga0466703_159061_3567_4094 175
18 3300042590 Ga0466690_210682 Ga0466690_210682_461_991 176
19 3300042593 Ga0466691_135382 Ga0466691_135382_4783_5313 176
20 3300042619 Ga0466726_184786 Ga0466726_184786_269_802 177
21 3300042636 Ga0466703_132938 Ga0466703_132938_16408_16941 177
22 3300042643 Ga0466704_090508 Ga0466704_090508_15260_15793 177
23 3300000089 AustNasuHG_c1006399 AustNasuHG_10063996 179
24 3300042596 Ga0466696_105547 Ga0466696_105547_4118_4660 180
25 3300042605 Ga0466716_051922 Ga0466716_051922_426_968 180
26 3300042612 Ga0466705_416718 Ga0466705_416718_1083_1625 180
27 3300042636 Ga0466703_380717 Ga0466703_380717_179_721 180
28 3300042605 Ga0466716_021401 Ga0466716_021401_415_963 182
29 3300010049 Ga0123356_12367891 Ga0123356_123678911 186
30 3300042595 Ga0466695_151841 Ga0466695_151841_8012_8599 186
31 3300042620 Ga0466728_146625 Ga0466728_146625_704_1264 186
32 3300042659 Ga0466733_022655 Ga0466733_022655_250_837 186
33 3300042656 Ga0466732_114721 Ga0466732_114721_193_780 187
34 3300042659 Ga0466733_031282 Ga0466733_031282_318_905 187
35 3300042593 Ga0466691_209330 Ga0466691_209330_2073_2666 188
36 3300042606 Ga0466719_123044 Ga0466719_123044_613_1179 188
37 3300042620 Ga0466728_123097 Ga0466728_123097_584_1150 188
38 3300042606 Ga0466719_035069 Ga0466719_035069_11645_12238 189
39 3300042614 Ga0466712_037568 Ga0466712_037568_2428_3006 192
40 3300042614 Ga0466712_163367 Ga0466712_163367_713_1291 192
41 3300002449 JGI24698J34947_10000409 JGI24698J34947_1000040918 193
42 3300002449 JGI24698J34947_10000688 JGI24698J34947_1000068817 193
43 3300002449 JGI24698J34947_10006352 JGI24698J34947_100063522 193
44 3300002449 JGI24698J34947_10009127 JGI24698J34947_100091279 193
45 3300002449 JGI24698J34947_10046265 JGI24698J34947_100462653 193
46 3300002449 JGI24698J34947_10046514 JGI24698J34947_100465143 193
47 3300042597 Ga0466699_309128 Ga0466699_309128_1636_2217 193
48 3300042636 Ga0466703_024259 Ga0466703_024259_11524_12105 193
49 3300042593 Ga0466691_070315 Ga0466691_070315_353_937 194
50 3300042614 Ga0466712_162563 Ga0466712_162563_444_1028 194
51 3300042616 Ga0466715_041382 Ga0466715_041382_4778_5362 194
52 3300042643 Ga0466704_309373 Ga0466704_309373_18566_19150 194
53 3300042652 Ga0466708_215966 Ga0466708_215966_8189_8773 194
54 3300002449 JGI24698J34947_10081186 JGI24698J34947_100811862 195
55 3300038395 Ga0415639_212173 Ga0415639_212173_412_999 195
56 3300042590 Ga0466690_353635 Ga0466690_353635_4710_5297 195
57 3300042593 Ga0466691_024704 Ga0466691_024704_1532_2119 195
58 3300042593 Ga0466691_075760 Ga0466691_075760_2714_3301 195
59 3300042593 Ga0466691_226094 Ga0466691_226094_10586_11173 195
60 3300042601 Ga0466707_094954 Ga0466707_094954_192_779 195
61 3300042605 Ga0466716_088441 Ga0466716_088441_450_1037 195
62 3300042605 Ga0466716_161805 Ga0466716_161805_242_829 195
63 3300042606 Ga0466719_264379 Ga0466719_264379_3199_3786 195
64 3300042616 Ga0466715_065478 Ga0466715_065478_24817_25404 195
65 3300042616 Ga0466715_120929 Ga0466715_120929_40282_40869 195
66 3300042618 Ga0466723_024654 Ga0466723_024654_1800_2387 195
67 3300042618 Ga0466723_036819 Ga0466723_036819_3040_3627 195
68 3300042618 Ga0466723_126542 Ga0466723_126542_500_1087 195
69 3300042619 Ga0466726_095381 Ga0466726_095381_3724_4311 195
70 3300042620 Ga0466728_108495 Ga0466728_108495_336_923 195
71 3300042624 Ga0466735_038334 Ga0466735_038334_162_749 195
72 3300042636 Ga0466703_181939 Ga0466703_181939_5637_6224 195
73 3300042643 Ga0466704_046500 Ga0466704_046500_14090_14677 195
74 3300042648 Ga0466709_066227 Ga0466709_066227_21989_22576 195
75 3300042652 Ga0466708_103796 Ga0466708_103796_38321_38908 195
76 3300042655 Ga0466727_272285 Ga0466727_272285_117_704 195
77 3300042659 Ga0466733_089083 Ga0466733_089083_2121_2708 195
78 3300042659 Ga0466733_150505 Ga0466733_150505_93_680 195
79 iso_pr_bacteria 2781125637 2781281273 195
80 iso_pr_bacteria 2781125649 2781306678 195
81 iso_pr_bacteria 2781125692 2781431534 195
82 3300002449 JGI24698J34947_10037305 JGI24698J34947_100373052 196
83 3300002450 JGI24695J34938_10002164 JGI24695J34938_100021642 196
84 3300005083 Ga0068305_10439010 Ga0068305_104390107 196
85 3300010049 Ga0123356_10018720 Ga0123356_100187201 196
86 3300010049 Ga0123356_10079176 Ga0123356_100791761 196
87 3300010049 Ga0123356_10847773 Ga0123356_108477731 196
88 3300010167 Ga0123353_10805341 Ga0123353_108053412 196
89 3300042594 Ga0466694_006279 Ga0466694_006279_175_765 196
90 3300042605 Ga0466716_260633 Ga0466716_260633_5628_6218 196
91 3300042609 Ga0466722_156992 Ga0466722_156992_154_744 196
92 3300042619 Ga0466726_187813 Ga0466726_187813_1083_1673 196
93 3300042620 Ga0466728_171577 Ga0466728_171577_14374_14964 196
94 3300042624 Ga0466735_146783 Ga0466735_146783_66_656 196
95 3300042652 Ga0466708_279571 Ga0466708_279571_3621_4211 196
96 iso_pr_bacteria 2781125688 2781423067 196
97 3300005071 Ga0068302_10380652 Ga0068302_103806522 197
98 3300010049 Ga0123356_10154711 Ga0123356_101547112 197
99 3300042597 Ga0466699_237898 Ga0466699_237898_12451_13044 197
100 3300042597 Ga0466699_424683 Ga0466699_424683_1311_1904 197
101 3300042606 Ga0466719_385575 Ga0466719_385575_676_1269 197
102 3300042614 Ga0466712_173060 Ga0466712_173060_8572_9165 197
103 3300042624 Ga0466735_205134 Ga0466735_205134_884_1477 197
104 3300042643 Ga0466704_063886 Ga0466704_063886_23896_24489 197
105 3300009826 Ga0123355_10274975 Ga0123355_102749752 198
106 3300010049 Ga0123356_10003994 Ga0123356_100039947 198
107 3300042616 Ga0466715_157935 Ga0466715_157935_2098_2694 198
108 3300042618 Ga0466723_299807 Ga0466723_299807_292_888 198
109 3300042620 Ga0466728_376125 Ga0466728_376125_54_650 198
110 3300042623 Ga0466734_075826 Ga0466734_075826_1170_1766 198
111 3300042648 Ga0466709_194612 Ga0466709_194612_9173_9769 198
112 3300042597 Ga0466699_427434 Ga0466699_427434_246_845 199
113 3300042614 Ga0466712_274160 Ga0466712_274160_730_1329 199
114 3300042615 Ga0466711_165879 Ga0466711_165879_2070_2669 199
115 3300002449 JGI24698J34947_10022727 JGI24698J34947_100227276 200
116 3300010049 Ga0123356_10314216 Ga0123356_103142161 200
117 3300042590 Ga0466690_313579 Ga0466690_313579_12078_12707 200
118 3300042594 Ga0466694_105188 Ga0466694_105188_321_923 200
119 3300042597 Ga0466699_382647 Ga0466699_382647_1087_1692 201
120 3300042619 Ga0466726_036320 Ga0466726_036320_2510_3115 201
121 3300042595 Ga0466695_158964 Ga0466695_158964_3647_4255 202
122 3300002449 JGI24698J34947_10087798 JGI24698J34947_100877981 204
123 3300010882 Ga0123354_10041677 Ga0123354_100416772 205
124 3300042609 Ga0466722_191664 Ga0466722_191664_72_692 206
125 3300042612 Ga0466705_182822 Ga0466705_182822_4207_4830 207
126 3300042618 Ga0466723_291555 Ga0466723_291555_10994_11674 207
127 3300042659 Ga0466733_149052 Ga0466733_149052_15303_15938 211
128 3300002450 JGI24695J34938_10035616 JGI24695J34938_100356163 214
129 3300042606 Ga0466719_444651 Ga0466719_444651_8684_9328 214
130 3300042655 Ga0466727_031941 Ga0466727_031941_8594_9253 219
131 3300042636 Ga0466703_337384 Ga0466703_337384_2079_2747 222
132 3300042594 Ga0466694_117912 Ga0466694_117912_113_784 223
133 3300042615 Ga0466711_433757 Ga0466711_433757_191_898 235
134 3300042643 Ga0466704_132165 Ga0466704_132165_24836_25603 255

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02545 Maf Maf-like protein 31 215 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02545 GO:0047429 nucleoside triphosphate diphosphatase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.