Protein Family IF09253

Metagenome Isolate
115 Members
53 Samples
102 Scaffolds
412.59 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_312847|Ga0466703_312847_7426_8757
Length
443 aa
Sequence
VLFLPAPGQKGEPLDIKNTKRRALNIFDIDLWSEIWITITRNKMRSLLTGFGVFWGIFMLVIMLGSGTALETGILKNVEGFATNTAFFFTDRTGKPFKGFRKGRSWEMHNSDVDVIRKTAQNVQYISPILFGGRAEGNVVYNDRAGAFNVRGVYPDFAKIEQQRFLFGRFINDVDVLHKRKVCVIGTRVYEEFFRKNEDPIGQQIRVKGIYFQIVGVVDGVSGIQIGGRSSETVAVPFSTFQQAYNQGDRVHFLGITARDGTDIEQMEQEVKSILRAQNKIAPDDEQATSSFNVSRMFNMFNSLFLGVRMLVWFVGIGTLLAGIVGVSNIMVVTVRERTREIGVRRALGAKPSKIVVQILTESLLLTSIAGLLGMSVGVGLLSVVDTLLSANPNPDMFFVHPRIDFASAMTASAVLLLSGVMAGIIPTWRALKIKAIDAIREE

📊 Sample Types

Isolate 11.3%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 25.5%
Termitidae 25.5%
Blattidae 17.6%
Unclassified 11.8%
Termopsidae 7.8%
Rhinotermitidae 5.9%
Passalidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
2 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
11 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
12 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
13 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
19 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
26 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
35 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
45 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
46 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
49 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_161232 3300042659 Bacteria 18123
2 Ga0466715_553683 3300042616 Bacteria 50351
3 Ga0466729_208101 3300042621 Bacteria 5001
4 Ga0466729_260704 3300042621 Bacteria 2484
5 Ga0466735_122595 3300042624 Bacteria 2238
6 Ga0466735_165095 3300042624 Bacteria 2937
7 Ga0466727_101219 3300042655 Bacteria 84035
8 Ga0466706_011910 3300042599 Bacteria 39915
9 Ga0466706_014049 3300042599 Bacteria 54325
10 Ga0466707_420009 3300042601 Bacteria 12228
11 Ga0466714_005036 3300042603 Bacteria 2143
12 Ga0466714_126469 3300042603 Bacteria 66148
13 Ga0466714_160623 3300042603 Bacteria 3153
14 Ga0466691_159360 3300042593 Bacteria 14354
15 Ga0466733_126529 3300042659 Bacteria 36461
16 Ga0466710_359195 3300042613 Unclassified 1531
17 Ga0466718_148809 3300042617 Bacteria 1754
18 Ga0466729_190426 3300042621 Bacteria 4330
19 Ga0466735_021423 3300042624 Bacteria 2773
20 Ga0466703_312847 3300042636 Bacteria 11553
21 Ga0466701_095274 3300042598 Bacteria 10560
22 Ga0466701_101814 3300042598 Bacteria 21696
23 Ga0466706_209610 3300042599 Bacteria 69562
24 Ga0466713_004252 3300042602 Bacteria 4039
25 Ga0466713_026669 3300042602 Bacteria 78730
26 Ga0466713_104393 3300042602 Bacteria 13296
27 Ga0466713_122827 3300042602 Bacteria 174567
28 Ga0466714_045220 3300042603 Bacteria 1729
29 Ga0466719_024552 3300042606 Bacteria 3021
30 Ga0466722_041850 3300042609 Bacteria 17417
31 Ga0466690_048468 3300042590 Bacteria 7092
32 Ga0466696_070746 3300042596 Bacteria 74081
33 JGI24699J35502_11133966 3300002509 Bacteria 21905
34 Ga0466733_149506 3300042659 Bacteria 259198
35 Ga0466723_347679 3300042618 Bacteria 27958
36 Ga0466726_254312 3300042619 Bacteria 11993
37 Ga0466726_493237 3300042619 Bacteria 10302
38 Ga0466728_204608 3300042620 Bacteria 8173
39 Ga0466735_046923 3300042624 Bacteria 1529
40 Ga0466735_104997 3300042624 Bacteria 7260
41 Ga0466735_118669 3300042624 Bacteria 4618
42 Ga0466704_448503 3300042643 Bacteria 16724
43 Ga0466707_156397 3300042601 Bacteria 2986
44 Ga0466714_084638 3300042603 Bacteria 4253
45 Ga0466719_563524 3300042606 Bacteria 2164
46 Ga0466722_182062 3300042609 Bacteria 36101
47 2227482972 2225789004 Bacteria 21758
48 JGI24696J40584_12955430 3300002834 Bacteria 2832
49 Ga0466705_068425 3300042612 Bacteria 36245
50 Ga0466733_216697 3300042659 Bacteria 189231
51 Ga0466712_098182 3300042614 Bacteria 3322
52 Ga0466734_036917 3300042623 Bacteria 1865
53 Ga0466735_056956 3300042624 Bacteria 4165
54 Ga0466735_065749 3300042624 Bacteria 2503
55 Ga0466706_027311 3300042599 Unclassified 14840
56 Ga0466706_119758 3300042599 Bacteria 63998
57 Ga0466713_082115 3300042602 Bacteria 17794
58 Ga0466713_120451 3300042602 Bacteria 2010
59 Ga0466714_110204 3300042603 Bacteria 1495
60 Ga0466714_113742 3300042603 Bacteria 44490
61 Ga0466716_018876 3300042605 Bacteria 27600
62 Ga0466696_002304 3300042596 Bacteria 6714
63 IMNBL1DRAFT_c0003499 3300000062 Bacteria 10055
64 IMNBL1DRAFT_c0004332 3300000062 Bacteria 8572
65 Ga0466733_092492 3300042659 Bacteria 17976
66 Ga0466733_138126 3300042659 Bacteria 81124
67 Ga0466708_073599 3300042652 Bacteria 2912
68 Ga0466706_071888 3300042599 Bacteria 2363
69 Ga0466707_397960 3300042601 Bacteria 42331
70 Ga0466714_043396 3300042603 Unclassified 2148
71 Ga0466714_127649 3300042603 Bacteria 1923
72 Ga0466719_332744 3300042606 Bacteria 1572
73 Ga0068302_10473739 3300005071 Bacteria 1354
74 Ga0068305_10003924 3300005083 Bacteria 8624
75 Ga0072941_1177329 3300005201 Bacteria 5496
76 Ga0466705_263821 3300042612 Bacteria 21616
77 Ga0466723_062543 3300042618 Bacteria 7962
78 Ga0123353_10226932 3300010167 Unclassified 2915
79 Ga0466730_084494 3300042625 Bacteria 3260
80 Ga0466709_228070 3300042648 Bacteria 41532
81 Ga0466701_069369 3300042598 Bacteria 58155
82 Ga0466706_002466 3300042599 Bacteria 39380
83 Ga0466713_139646 3300042602 Bacteria 516516
84 Ga0466722_061976 3300042609 Bacteria 32560
85 Ga0466690_180311 3300042590 Bacteria 24767
86 Ga0466696_428038 3300042596 Bacteria 2711
87 Ga0466703_070729 3300042636 Bacteria 4268
88 Ga0466706_046108 3300042599 Bacteria 5551
89 Ga0466706_129722 3300042599 Bacteria 9634
90 Ga0466706_156630 3300042599 Bacteria 44167
91 Ga0466700_019574 3300042600 Bacteria 4005
92 Ga0466714_110748 3300042603 Bacteria 4141
93 Ga0466714_147349 3300042603 Bacteria 1537
94 Ga0265387_1001428 3300024582 Bacteria 3501
95 Ga0466690_309503 3300042590 Bacteria 11550
96 Ga0466733_127034 3300042659 Bacteria 6921
97 Ga0466733_201260 3300042659 Bacteria 4194
98 Ga0466705_496566 3300042612 Bacteria 17204
99 Ga0123357_10319236 3300009784 Bacteria 1537
100 Ga0466708_083149 3300042652 Bacteria 19271
101 Ga0466716_443055 3300042605 Bacteria 5421
102 Ga0466696_215596 3300042596 Bacteria 86390

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_126529 Ga0466733_126529_41_1147 368
2 3300042603 Ga0466714_005036 Ga0466714_005036_1017_2132 371
3 3300042623 Ga0466734_036917 Ga0466734_036917_478_1725 379
4 3300042609 Ga0466722_061976 Ga0466722_061976_23201_24349 382
5 3300042602 Ga0466713_026669 Ga0466713_026669_74681_75937 383
6 3300042624 Ga0466735_056956 Ga0466735_056956_18_1172 384
7 3300042624 Ga0466735_122595 Ga0466735_122595_13_1167 384
8 3300042596 Ga0466696_428038 Ga0466696_428038_1465_2622 385
9 3300042625 Ga0466730_084494 Ga0466730_084494_459_1718 385
10 3300042601 Ga0466707_397960 Ga0466707_397960_35472_36725 387
11 3300042659 Ga0466733_216697 Ga0466733_216697_107597_108853 387
12 3300042598 Ga0466701_069369 Ga0466701_069369_14457_15710 388
13 3300042596 Ga0466696_215596 Ga0466696_215596_46184_47437 389
14 3300042598 Ga0466701_095274 Ga0466701_095274_9116_10369 389
15 3300042624 Ga0466735_021423 Ga0466735_021423_1193_2446 390
16 3300042602 Ga0466713_082115 Ga0466713_082115_11986_13233 391
17 3300042601 Ga0466707_156397 Ga0466707_156397_1128_2381 392
18 3300009784 Ga0123357_10319236 Ga0123357_103192361 395
19 3300042602 Ga0466713_104393 Ga0466713_104393_7758_9011 395
20 3300005083 Ga0068305_10003924 Ga0068305_100039244 396
21 3300002834 JGI24696J40584_12955430 JGI24696J40584_129554301 397
22 3300010167 Ga0123353_10226932 Ga0123353_102269322 398
23 3300042606 Ga0466719_563524 Ga0466719_563524_587_1789 400
24 3300042652 Ga0466708_073599 Ga0466708_073599_177_1379 400
25 3300042601 Ga0466707_420009 Ga0466707_420009_4549_5808 401
26 3300042602 Ga0466713_122827 Ga0466713_122827_146326_147588 406
27 3300042624 Ga0466735_118669 Ga0466735_118669_860_2116 408
28 3300005201 Ga0072941_1177329 Ga0072941_11773292 409
29 3300042602 Ga0466713_004252 Ga0466713_004252_251_1504 409
30 3300002509 JGI24699J35502_11133966 JGI24699J35502_1113396610 410
31 3300042602 Ga0466713_120451 Ga0466713_120451_333_1586 411
32 3300042590 Ga0466690_309503 Ga0466690_309503_2958_4199 413
33 3300042606 Ga0466719_024552 Ga0466719_024552_1559_2800 413
34 3300042599 Ga0466706_046108 Ga0466706_046108_791_2035 414
35 3300042599 Ga0466706_129722 Ga0466706_129722_3469_4713 414
36 3300042599 Ga0466706_156630 Ga0466706_156630_4310_5554 414
37 3300042621 Ga0466729_190426 Ga0466729_190426_2191_3453 414
38 3300042624 Ga0466735_065749 Ga0466735_065749_699_1943 414
39 3300042624 Ga0466735_104997 Ga0466735_104997_3101_4345 414
40 3300042624 Ga0466735_165095 Ga0466735_165095_134_1378 414
41 iso_pr_bacteria 2820765201 2820767033 414
42 2225789004 2227482972 2227945564 416
43 iso_pr_bacteria 2940193328 2940195280 416
44 iso_pr_bacteria 2940336608 2940338555 416
45 3300042596 Ga0466696_070746 Ga0466696_070746_27550_28803 417
46 3300042603 Ga0466714_147349 Ga0466714_147349_230_1498 417
47 3300042609 Ga0466722_182062 Ga0466722_182062_27521_28774 417
48 3300042612 Ga0466705_496566 Ga0466705_496566_5834_7087 417
49 3300042613 Ga0466710_359195 Ga0466710_359195_65_1318 417
50 3300042614 Ga0466712_098182 Ga0466712_098182_76_1359 417
51 3300042618 Ga0466723_062543 Ga0466723_062543_3579_4832 417
52 3300042636 Ga0466703_070729 Ga0466703_070729_2051_3304 417
53 3300042655 Ga0466727_101219 Ga0466727_101219_24649_25902 417
54 iso_pr_bacteria 2910949487 2910951240 417
55 3300000062 IMNBL1DRAFT_c0003499 IMNBL1DRAFT_00034993 418
56 3300000062 IMNBL1DRAFT_c0004332 IMNBL1DRAFT_00043326 418
57 3300005071 Ga0068302_10473739 Ga0068302_104737391 418
58 3300042598 Ga0466701_101814 Ga0466701_101814_2796_4052 418
59 3300042599 Ga0466706_011910 Ga0466706_011910_29271_30527 418
60 3300042599 Ga0466706_014049 Ga0466706_014049_48921_50177 418
61 3300042599 Ga0466706_027311 Ga0466706_027311_11351_12607 418
62 3300042599 Ga0466706_071888 Ga0466706_071888_43_1299 418
63 3300042599 Ga0466706_119758 Ga0466706_119758_4592_5848 418
64 3300042599 Ga0466706_209610 Ga0466706_209610_3633_4889 418
65 3300042602 Ga0466713_139646 Ga0466713_139646_26645_27901 418
66 3300042609 Ga0466722_041850 Ga0466722_041850_14537_15793 418
67 3300042612 Ga0466705_263821 Ga0466705_263821_16226_17482 418
68 3300042616 Ga0466715_553683 Ga0466715_553683_46788_48044 418
69 3300042619 Ga0466726_254312 Ga0466726_254312_2778_4034 418
70 3300042619 Ga0466726_493237 Ga0466726_493237_7325_8581 418
71 3300042648 Ga0466709_228070 Ga0466709_228070_31495_32751 418
72 3300042659 Ga0466733_092492 Ga0466733_092492_11664_12920 418
73 iso_pr_bacteria 2820762746 2820763623 418
74 iso_pr_bacteria 2910926975 2910928692 418
75 iso_pr_bacteria 2910942425 2910944322 418
76 iso_pr_bacteria 2940244548 2940246046 418
77 iso_pr_bacteria 2940248789 2940249870 418
78 iso_pr_bacteria 2940253009 2940253944 418
79 iso_pr_bacteria 2940257232 2940258112 418
80 iso_pr_bacteria 8100166142 8100169048 418
81 3300042599 Ga0466706_002466 Ga0466706_002466_12993_14252 419
82 3300042605 Ga0466716_443055 Ga0466716_443055_2601_3860 419
83 3300042590 Ga0466690_048468 Ga0466690_048468_418_1680 420
84 3300042590 Ga0466690_180311 Ga0466690_180311_422_1684 420
85 3300042593 Ga0466691_159360 Ga0466691_159360_7192_8454 420
86 3300042596 Ga0466696_002304 Ga0466696_002304_3638_4900 420
87 3300042600 Ga0466700_019574 Ga0466700_019574_2374_3636 420
88 3300042603 Ga0466714_127649 Ga0466714_127649_210_1472 420
89 3300042605 Ga0466716_018876 Ga0466716_018876_7871_9133 420
90 3300042606 Ga0466719_332744 Ga0466719_332744_193_1455 420
91 3300042617 Ga0466718_148809 Ga0466718_148809_381_1643 420
92 3300042618 Ga0466723_347679 Ga0466723_347679_21588_22850 420
93 3300042620 Ga0466728_204608 Ga0466728_204608_4769_6031 420
94 3300042621 Ga0466729_208101 Ga0466729_208101_1733_2995 420
95 3300042621 Ga0466729_260704 Ga0466729_260704_416_1678 420
96 3300042643 Ga0466704_448503 Ga0466704_448503_14429_15691 420
97 3300042652 Ga0466708_083149 Ga0466708_083149_16487_17749 420
98 3300042659 Ga0466733_127034 Ga0466733_127034_5560_6822 420
99 iso_pr_bacteria 2820759988 2820762008 420
100 3300042603 Ga0466714_110748 Ga0466714_110748_1811_3076 421
101 3300042603 Ga0466714_113742 Ga0466714_113742_33856_35121 421
102 3300042603 Ga0466714_043396 Ga0466714_043396_182_1450 422
103 3300042603 Ga0466714_110204 Ga0466714_110204_188_1456 422
104 3300042603 Ga0466714_160623 Ga0466714_160623_1734_3002 422
105 3300042659 Ga0466733_149506 Ga0466733_149506_194912_196180 422
106 3300024582 Ga0265387_1001428 Ga0265387_10014284 423
107 3300042603 Ga0466714_084638 Ga0466714_084638_1315_2586 423
108 3300042659 Ga0466733_138126 Ga0466733_138126_17032_18303 423
109 3300042659 Ga0466733_161232 Ga0466733_161232_15431_16702 423
110 3300042603 Ga0466714_045220 Ga0466714_045220_334_1611 425
111 3300042603 Ga0466714_126469 Ga0466714_126469_23529_24806 425
112 3300042612 Ga0466705_068425 Ga0466705_068425_20049_21371 440
113 3300042636 Ga0466703_312847 Ga0466703_312847_7426_8757 443
114 3300042624 Ga0466735_046923 Ga0466735_046923_104_1468 448
115 3300042659 Ga0466733_201260 Ga0466733_201260_478_1956 474

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02687 FtsX FtsX-like permease family 314 435 0.95
PF12704 MacB_PCD MacB-like periplasmic core domain 46 273 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02687 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.