Protein Family IF09251
Metagenome
Isolate
134
Members
57
Samples
110
Scaffolds
559.06
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_308252|Ga0466703_308252_7631_9286
- Length
- 507 aa
- Sequence
- VGQKSLTTTLKHAISGNKLAHAYLFCGPRGVGKTSCARIFAKTINCLNQTESFNEQRSYNYNIHELDAASNNSVDDIRALIEQVRIPPAIGKYKVFIIDEVHMLSTNAFNAFLKTLEEPPRHAIFILATTEKHKVLPTILSRCQIYDFLRISIADTVEHLEYVAQQENVKAEPEALNVIAQKADGGMRDALSIFDQAVSFTNGNVTYQAVIDNLNVLDYEYYFRLTDNMLEGNVRQALLLLNEILGRGFDGQNILSGLASHFRDLFVCKDEATLVLFEVGASIRERYRETARRCSDAFLYRAIELTNTCDLNYRASRNKRLLLELTLIQLCQLMQSPLIEPVDVPGEQRQTPPQAAPVAVVSTSIKKLMKEELSDADKQAMPTEKEQLTPIDVAAMIECWDEYAKAIEGNAYLQSTMVNCKPSLGEDYSFEVSVHNRVQHDELLNDSVNLLSYMRQQLKNTRIRMCVRISETNEKKLAYTSSEKYEHLLNINPLLHKLKEEFNLSPD
Sample Types
Isolate
17.9%
Metagenome
82.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
35.1%
Kalotermitidae
22.8%
Termitidae
19.3%
Unclassified
12.3%
Termopsidae
5.3%
Rhinotermitidae
3.5%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 17 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 18 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 19 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 20 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 21 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 28 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 29 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 30 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 33 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 34 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 46 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 47 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 48 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 49 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 53 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_308252 | 3300042636 | Bacteria | 9658 |
| 2 | Ga0466725_376735 | 3300042654 | Bacteria | 6114 |
| 3 | Ga0466727_069574 | 3300042655 | Bacteria | 6585 |
| 4 | Ga0466713_013897 | 3300042602 | Bacteria | 4432 |
| 5 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 6 | Ga0466716_221991 | 3300042605 | Bacteria | 25521 |
| 7 | Ga0466716_263613 | 3300042605 | Bacteria | 11222 |
| 8 | Ga0466722_199658 | 3300042609 | Bacteria | 7404 |
| 9 | Ga0466690_048635 | 3300042590 | Bacteria | 14569 |
| 10 | Ga0123357_10022512 | 3300009784 | Bacteria | 8450 |
| 11 | Ga0123354_10048152 | 3300010882 | Bacteria | 6486 |
| 12 | Ga0466711_232111 | 3300042615 | Bacteria | 5084 |
| 13 | Ga0466711_239934 | 3300042615 | Bacteria | 17196 |
| 14 | JGI24705J35276_12235571 | 3300002504 | Bacteria | 6685 |
| 15 | Ga0123357_10000272 | 3300009784 | Bacteria | 49371 |
| 16 | Ga0123357_10000667 | 3300009784 | Bacteria | 34305 |
| 17 | Ga0466735_019998 | 3300042624 | Bacteria | 4967 |
| 18 | Ga0466704_155228 | 3300042643 | Bacteria | 13903 |
| 19 | Ga0466704_199900 | 3300042643 | Bacteria | 2689 |
| 20 | Ga0466704_421641 | 3300042643 | Bacteria | 3368 |
| 21 | Ga0466727_348531 | 3300042655 | Bacteria | 2788 |
| 22 | Ga0466707_160481 | 3300042601 | Bacteria | 32425 |
| 23 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 24 | Ga0123357_10004638 | 3300009784 | Bacteria | 16215 |
| 25 | Ga0466705_473025 | 3300042612 | Bacteria | 8006 |
| 26 | Ga0466723_147177 | 3300042618 | Bacteria | 19938 |
| 27 | Ga0466728_302977 | 3300042620 | Bacteria | 25242 |
| 28 | Ga0068305_10059018 | 3300005083 | Bacteria | 5156 |
| 29 | Ga0466703_390836 | 3300042636 | Bacteria | 17272 |
| 30 | Ga0466704_145824 | 3300042643 | Bacteria | 3622 |
| 31 | Ga0466704_528440 | 3300042643 | Bacteria | 18129 |
| 32 | Ga0466709_092384 | 3300042648 | Bacteria | 14108 |
| 33 | Ga0466700_055189 | 3300042600 | Bacteria | 4124 |
| 34 | Ga0466707_291043 | 3300042601 | Bacteria | 1741 |
| 35 | Ga0466722_050258 | 3300042609 | Bacteria | 3067 |
| 36 | Ga0466698_359841 | 3300042610 | Bacteria | 2436 |
| 37 | Ga0123357_10028233 | 3300009784 | Bacteria | 7591 |
| 38 | Ga0123357_10031832 | 3300009784 | Bacteria | 7156 |
| 39 | Ga0123354_10003491 | 3300010882 | Bacteria | 21728 |
| 40 | Ga0466715_136023 | 3300042616 | Bacteria | 8171 |
| 41 | JGI24699J35502_11134108 | 3300002509 | Bacteria | 31504 |
| 42 | Ga0466705_223014 | 3300042612 | Bacteria | 17196 |
| 43 | Ga0466735_030140 | 3300042624 | Bacteria | 6167 |
| 44 | Ga0466704_574583 | 3300042643 | Bacteria | 2716 |
| 45 | Ga0466708_101648 | 3300042652 | Bacteria | 32818 |
| 46 | Ga0466700_445411 | 3300042600 | Bacteria | 14608 |
| 47 | Ga0466716_112700 | 3300042605 | Bacteria | 8750 |
| 48 | Ga0466690_181285 | 3300042590 | Bacteria | 3366 |
| 49 | Ga0466692_076352 | 3300042591 | Bacteria | 50046 |
| 50 | Ga0466696_242324 | 3300042596 | Bacteria | 39108 |
| 51 | Ga0123357_10033022 | 3300009784 | Bacteria | 7031 |
| 52 | Ga0466711_384618 | 3300042615 | Bacteria | 22548 |
| 53 | Ga0466715_045974 | 3300042616 | Bacteria | 42084 |
| 54 | Ga0466715_173820 | 3300042616 | Bacteria | 65966 |
| 55 | Ga0466715_642914 | 3300042616 | Bacteria | 17581 |
| 56 | JGI24702J35022_10013219 | 3300002462 | Bacteria | 4576 |
| 57 | JGI24699J35502_11133858 | 3300002509 | Bacteria | 17217 |
| 58 | Ga0466705_220129 | 3300042612 | Bacteria | 17831 |
| 59 | Ga0466705_318819 | 3300042612 | Bacteria | 8925 |
| 60 | Ga0466733_043800 | 3300042659 | Bacteria | 7049 |
| 61 | Ga0466703_432391 | 3300042636 | Bacteria | 4185 |
| 62 | Ga0466704_237213 | 3300042643 | Bacteria | 31979 |
| 63 | Ga0466707_012359 | 3300042601 | Bacteria | 8532 |
| 64 | Ga0123354_10022745 | 3300010882 | Bacteria | 9879 |
| 65 | Ga0466711_138683 | 3300042615 | Bacteria | 30731 |
| 66 | Ga0466727_166876 | 3300042655 | Bacteria | 3698 |
| 67 | Ga0466707_063394 | 3300042601 | Bacteria | 26550 |
| 68 | Ga0466713_078938 | 3300042602 | Bacteria | 3905 |
| 69 | Ga0466713_150648 | 3300042602 | Bacteria | 6802 |
| 70 | Ga0466716_175816 | 3300042605 | Bacteria | 4255 |
| 71 | Ga0466722_116260 | 3300042609 | Bacteria | 15838 |
| 72 | Ga0466692_117273 | 3300042591 | Bacteria | 3132 |
| 73 | Ga0466696_248241 | 3300042596 | Bacteria | 3345 |
| 74 | Ga0123357_10004282 | 3300009784 | Bacteria | 16691 |
| 75 | Ga0123354_10001302 | 3300010882 | Bacteria | 29724 |
| 76 | Ga0466711_191099 | 3300042615 | Bacteria | 3628 |
| 77 | Ga0466711_214846 | 3300042615 | Bacteria | 20080 |
| 78 | IMNBL1DRAFT_c0001322 | 3300000062 | Bacteria | 18635 |
| 79 | Ga0466704_115523 | 3300042643 | Bacteria | 13352 |
| 80 | Ga0466704_135115 | 3300042643 | Bacteria | 9519 |
| 81 | Ga0466704_170415 | 3300042643 | Bacteria | 25587 |
| 82 | Ga0466701_039482 | 3300042598 | Bacteria | 104864 |
| 83 | Ga0466707_215954 | 3300042601 | Bacteria | 4292 |
| 84 | Ga0466707_247680 | 3300042601 | Bacteria | 13317 |
| 85 | Ga0466719_159671 | 3300042606 | Bacteria | 27854 |
| 86 | Ga0466690_158972 | 3300042590 | Bacteria | 37920 |
| 87 | Ga0123357_10004289 | 3300009784 | Bacteria | 16683 |
| 88 | Ga0123357_10045487 | 3300009784 | Bacteria | 5956 |
| 89 | Ga0123354_10006666 | 3300010882 | Bacteria | 17211 |
| 90 | Ga0123354_10061329 | 3300010882 | Bacteria | 5551 |
| 91 | Ga0466723_230208 | 3300042618 | Bacteria | 14199 |
| 92 | Ga0466726_496750 | 3300042619 | Bacteria | 2287 |
| 93 | JGI24705J35276_12231664 | 3300002504 | Bacteria | 4019 |
| 94 | JGI24699J35502_11133841 | 3300002509 | Bacteria | 16874 |
| 95 | Ga0466705_264568 | 3300042612 | Bacteria | 2270 |
| 96 | Ga0466703_233846 | 3300042636 | Bacteria | 8674 |
| 97 | Ga0466704_041418 | 3300042643 | Bacteria | 6792 |
| 98 | Ga0466704_219190 | 3300042643 | Bacteria | 28029 |
| 99 | Ga0466707_260608 | 3300042601 | Bacteria | 6090 |
| 100 | Ga0466713_048509 | 3300042602 | Bacteria | 5342 |
| 101 | Ga0466716_116162 | 3300042605 | Bacteria | 19209 |
| 102 | Ga0466716_230301 | 3300042605 | Bacteria | 8125 |
| 103 | Ga0466719_388414 | 3300042606 | Bacteria | 11249 |
| 104 | Ga0466656_358179 | 3300042550 | Bacteria | 2789 |
| 105 | Ga0123357_10134421 | 3300009784 | Bacteria | 3064 |
| 106 | Ga0123357_10149921 | 3300009784 | Bacteria | 2834 |
| 107 | Ga0466711_074628 | 3300042615 | Bacteria | 5999 |
| 108 | Ga0466723_180881 | 3300042618 | Bacteria | 3356 |
| 109 | Ga0466723_194429 | 3300042618 | Bacteria | 44464 |
| 110 | IMNBL1DRAFT_c0001095 | 3300000062 | Bacteria | 20769 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_239934 | Ga0466711_239934_8296_10002 | 498 |
| 2 | 3300042616 | Ga0466715_045974 | Ga0466715_045974_35051_36745 | 498 |
| 3 | 3300042602 | Ga0466713_048509 | Ga0466713_048509_3470_5155 | 499 |
| 4 | 3300042605 | Ga0466716_116162 | Ga0466716_116162_2157_3659 | 500 |
| 5 | 3300042636 | Ga0466703_308252 | Ga0466703_308252_7631_9286 | 507 |
| 6 | 3300042615 | Ga0466711_214846 | Ga0466711_214846_17058_18785 | 510 |
| 7 | 3300042643 | Ga0466704_528440 | Ga0466704_528440_2423_4138 | 510 |
| 8 | 3300002462 | JGI24702J35022_10013219 | JGI24702J35022_100132195 | 515 |
| 9 | 3300010882 | Ga0123354_10048152 | Ga0123354_1004815211 | 517 |
| 10 | 3300042605 | Ga0466716_112700 | Ga0466716_112700_190_1890 | 517 |
| 11 | 3300042618 | Ga0466723_180881 | Ga0466723_180881_1508_3181 | 520 |
| 12 | 3300042655 | Ga0466727_348531 | Ga0466727_348531_958_2658 | 521 |
| 13 | 3300042643 | Ga0466704_145824 | Ga0466704_145824_788_2479 | 522 |
| 14 | 3300042643 | Ga0466704_421641 | Ga0466704_421641_1127_2821 | 522 |
| 15 | 3300009784 | Ga0123357_10033022 | Ga0123357_100330227 | 528 |
| 16 | 3300042601 | Ga0466707_012359 | Ga0466707_012359_1958_3601 | 528 |
| 17 | 3300042605 | Ga0466716_263613 | Ga0466716_263613_5555_7228 | 528 |
| 18 | 3300042643 | Ga0466704_115523 | Ga0466704_115523_10432_12021 | 529 |
| 19 | 3300042643 | Ga0466704_170415 | Ga0466704_170415_9901_11601 | 529 |
| 20 | 3300042601 | Ga0466707_291043 | Ga0466707_291043_62_1714 | 537 |
| 21 | 3300042615 | Ga0466711_191099 | Ga0466711_191099_403_2106 | 537 |
| 22 | 3300042601 | Ga0466707_215954 | Ga0466707_215954_523_2253 | 540 |
| 23 | 3300042615 | Ga0466711_384618 | Ga0466711_384618_970_2673 | 540 |
| 24 | 3300042600 | Ga0466700_445411 | Ga0466700_445411_4825_6504 | 541 |
| 25 | 3300042643 | Ga0466704_237213 | Ga0466704_237213_13831_15507 | 541 |
| 26 | 3300042615 | Ga0466711_232111 | Ga0466711_232111_1241_2953 | 542 |
| 27 | 3300042591 | Ga0466692_076352 | Ga0466692_076352_33346_35037 | 543 |
| 28 | 3300009784 | Ga0123357_10000667 | Ga0123357_100006674 | 544 |
| 29 | 3300005083 | Ga0068305_10059018 | Ga0068305_100590183 | 545 |
| 30 | 3300009784 | Ga0123357_10004638 | Ga0123357_1000463814 | 545 |
| 31 | 3300010882 | Ga0123354_10061329 | Ga0123354_100613293 | 545 |
| 32 | 3300042602 | Ga0466713_150648 | Ga0466713_150648_443_2158 | 545 |
| 33 | 3300042624 | Ga0466735_030140 | Ga0466735_030140_2942_4630 | 545 |
| 34 | 3300042602 | Ga0466713_078938 | Ga0466713_078938_272_1987 | 546 |
| 35 | 3300042609 | Ga0466722_050258 | Ga0466722_050258_831_2519 | 547 |
| 36 | 3300042612 | Ga0466705_223014 | Ga0466705_223014_6144_7823 | 547 |
| 37 | 3300042643 | Ga0466704_041418 | Ga0466704_041418_4188_5858 | 547 |
| 38 | 3300042598 | Ga0466701_039482 | Ga0466701_039482_93351_95060 | 548 |
| 39 | 3300042643 | Ga0466704_574583 | Ga0466704_574583_349_2133 | 549 |
| 40 | 3300042655 | Ga0466727_166876 | Ga0466727_166876_295_1992 | 549 |
| 41 | 3300042596 | Ga0466696_242324 | Ga0466696_242324_29505_31220 | 551 |
| 42 | 3300042609 | Ga0466722_116260 | Ga0466722_116260_752_2428 | 553 |
| 43 | 3300042618 | Ga0466723_230208 | Ga0466723_230208_5476_7275 | 553 |
| 44 | 3300042616 | Ga0466715_642914 | Ga0466715_642914_5418_7082 | 554 |
| 45 | 3300042659 | Ga0466733_043800 | Ga0466733_043800_1255_2973 | 554 |
| 46 | 3300009784 | Ga0123357_10004282 | Ga0123357_1000428213 | 555 |
| 47 | 3300009784 | Ga0123357_10134421 | Ga0123357_101344212 | 555 |
| 48 | 3300042590 | Ga0466690_181285 | Ga0466690_181285_949_2727 | 555 |
| 49 | 3300009784 | Ga0123357_10149921 | Ga0123357_101499213 | 556 |
| 50 | 3300042615 | Ga0466711_074628 | Ga0466711_074628_901_2619 | 556 |
| 51 | 3300042643 | Ga0466704_135115 | Ga0466704_135115_1432_3102 | 556 |
| 52 | 3300002509 | JGI24699J35502_11133858 | JGI24699J35502_1113385813 | 557 |
| 53 | 3300042590 | Ga0466690_048635 | Ga0466690_048635_181_1854 | 557 |
| 54 | 3300042615 | Ga0466711_138683 | Ga0466711_138683_13774_15447 | 557 |
| 55 | 3300042602 | Ga0466713_013897 | Ga0466713_013897_1201_2931 | 558 |
| 56 | 3300042616 | Ga0466715_173820 | Ga0466715_173820_20266_21942 | 558 |
| 57 | 3300042636 | Ga0466703_390836 | Ga0466703_390836_7373_9091 | 558 |
| 58 | 3300042655 | Ga0466727_069574 | Ga0466727_069574_2791_4467 | 558 |
| 59 | 3300042601 | Ga0466707_160481 | Ga0466707_160481_1442_3121 | 559 |
| 60 | 3300042601 | Ga0466707_063394 | Ga0466707_063394_11109_12791 | 560 |
| 61 | 3300042624 | Ga0466735_019998 | Ga0466735_019998_15_1739 | 560 |
| 62 | 3300042605 | Ga0466716_230301 | Ga0466716_230301_5429_7159 | 561 |
| 63 | 3300002509 | JGI24699J35502_11134108 | JGI24699J35502_111341084 | 562 |
| 64 | 3300010882 | Ga0123354_10001302 | Ga0123354_1000130223 | 562 |
| 65 | 3300042550 | Ga0466656_358179 | Ga0466656_358179_1078_2766 | 562 |
| 66 | 3300042609 | Ga0466722_199658 | Ga0466722_199658_5287_6975 | 562 |
| 67 | iso_pr_bacteria | 2820759988 | 2820761010 | 562 |
| 68 | 3300009784 | Ga0123357_10004289 | Ga0123357_100042898 | 563 |
| 69 | 3300009784 | Ga0123357_10031832 | Ga0123357_100318326 | 563 |
| 70 | 3300010882 | Ga0123354_10022745 | Ga0123354_100227458 | 563 |
| 71 | 3300042601 | Ga0466707_260608 | Ga0466707_260608_2682_4373 | 563 |
| 72 | 3300042610 | Ga0466698_359841 | Ga0466698_359841_671_2362 | 563 |
| 73 | 3300042618 | Ga0466723_147177 | Ga0466723_147177_4763_6454 | 563 |
| 74 | 3300042652 | Ga0466708_101648 | Ga0466708_101648_1485_3176 | 563 |
| 75 | 3300010882 | Ga0123354_10003491 | Ga0123354_1000349115 | 564 |
| 76 | 3300010882 | Ga0123354_10006666 | Ga0123354_1000666612 | 564 |
| 77 | 3300042590 | Ga0466690_158972 | Ga0466690_158972_1673_3391 | 564 |
| 78 | 3300042602 | Ga0466713_082426 | Ga0466713_082426_24823_26517 | 564 |
| 79 | 3300042636 | Ga0466703_432391 | Ga0466703_432391_2055_3749 | 564 |
| 80 | 3300009784 | Ga0123357_10028233 | Ga0123357_100282337 | 565 |
| 81 | 3300042619 | Ga0466726_496750 | Ga0466726_496750_241_1938 | 565 |
| 82 | 3300042643 | Ga0466704_199900 | Ga0466704_199900_352_2106 | 565 |
| 83 | 3300042654 | Ga0466725_376735 | Ga0466725_376735_3809_5506 | 565 |
| 84 | 3300000062 | IMNBL1DRAFT_c0001322 | IMNBL1DRAFT_00013223 | 566 |
| 85 | 3300042612 | Ga0466705_264568 | Ga0466705_264568_383_2086 | 567 |
| 86 | 3300042636 | Ga0466703_233846 | Ga0466703_233846_6550_8271 | 568 |
| 87 | iso_pr_bacteria | 2820762746 | 2820763335 | 568 |
| 88 | 3300002509 | JGI24699J35502_11133841 | JGI24699J35502_111338412 | 569 |
| 89 | 3300042606 | Ga0466719_388414 | Ga0466719_388414_668_2377 | 569 |
| 90 | 3300042612 | Ga0466705_473025 | Ga0466705_473025_913_2643 | 569 |
| 91 | 3300009784 | Ga0123357_10000272 | Ga0123357_1000027229 | 570 |
| 92 | 3300009784 | Ga0123357_10045487 | Ga0123357_100454873 | 570 |
| 93 | 3300042643 | Ga0466704_155228 | Ga0466704_155228_9590_11446 | 570 |
| 94 | 3300042591 | Ga0466692_117273 | Ga0466692_117273_1138_2853 | 571 |
| 95 | 3300042605 | Ga0466716_175816 | Ga0466716_175816_254_1972 | 572 |
| 96 | 3300002504 | JGI24705J35276_12231664 | JGI24705J35276_122316643 | 573 |
| 97 | 3300002504 | JGI24705J35276_12235571 | JGI24705J35276_122355712 | 573 |
| 98 | 3300042602 | Ga0466713_064405 | Ga0466713_064405_129889_131643 | 573 |
| 99 | 3300042606 | Ga0466719_159671 | Ga0466719_159671_14640_16433 | 574 |
| 100 | 3300042601 | Ga0466707_247680 | Ga0466707_247680_2617_4344 | 575 |
| 101 | iso_pr_bacteria | 2820778767 | 2820779175 | 575 |
| 102 | 3300000062 | IMNBL1DRAFT_c0001095 | IMNBL1DRAFT_000109519 | 576 |
| 103 | 3300042596 | Ga0466696_248241 | Ga0466696_248241_1537_3267 | 576 |
| 104 | iso_pr_bacteria | 2940199050 | 2940199401 | 577 |
| 105 | iso_pr_bacteria | 2940346213 | 2940346463 | 577 |
| 106 | iso_pr_bacteria | 2695420314 | 2695471615 | 579 |
| 107 | iso_pr_bacteria | 2940209341 | 2940209409 | 580 |
| 108 | 3300042612 | Ga0466705_220129 | Ga0466705_220129_11915_13660 | 581 |
| 109 | iso_pr_bacteria | 2940202316 | 2940204884 | 582 |
| 110 | iso_pr_bacteria | 2940205530 | 2940207793 | 583 |
| 111 | iso_pr_bacteria | 2940212447 | 2940214708 | 583 |
| 112 | iso_pr_bacteria | 2940298504 | 2940300767 | 583 |
| 113 | iso_pr_bacteria | 2940302308 | 2940304570 | 583 |
| 114 | iso_pr_bacteria | 2940306115 | 2940308128 | 583 |
| 115 | iso_pr_bacteria | 2940309933 | 2940311973 | 583 |
| 116 | iso_pr_bacteria | 2940313741 | 2940315780 | 583 |
| 117 | iso_pr_bacteria | 2940317558 | 2940319601 | 583 |
| 118 | iso_pr_bacteria | 2940321370 | 2940323206 | 583 |
| 119 | iso_pr_bacteria | 2940325180 | 2940327441 | 583 |
| 120 | iso_pr_bacteria | 2940328985 | 2940331241 | 583 |
| 121 | iso_pr_bacteria | 2940332795 | 2940334832 | 583 |
| 122 | 3300042620 | Ga0466728_302977 | Ga0466728_302977_3491_5290 | 584 |
| 123 | iso_pr_bacteria | 2910942425 | 2910943412 | 584 |
| 124 | 3300042605 | Ga0466716_221991 | Ga0466716_221991_17714_19540 | 588 |
| 125 | iso_pr_bacteria | 2923982719 | 2923982747 | 588 |
| 126 | iso_pr_bacteria | 2940371297 | 2940372819 | 588 |
| 127 | 3300042612 | Ga0466705_318819 | Ga0466705_318819_2385_4241 | 590 |
| 128 | 3300042643 | Ga0466704_219190 | Ga0466704_219190_15308_17083 | 591 |
| 129 | iso_pr_bacteria | 2940195863 | 2940197286 | 591 |
| 130 | 3300042616 | Ga0466715_136023 | Ga0466715_136023_2353_4170 | 598 |
| 131 | 3300042600 | Ga0466700_055189 | Ga0466700_055189_2201_4012 | 603 |
| 132 | 3300042648 | Ga0466709_092384 | Ga0466709_092384_11932_13746 | 604 |
| 133 | 3300042618 | Ga0466723_194429 | Ga0466723_194429_4729_6549 | 606 |
| 134 | 3300009784 | Ga0123357_10022512 | Ga0123357_100225123 | 610 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF22608 | DNAX_ATPase_lid | DNA polymerase III clamp loader subunit, ATPase lid domain | 157 | 203 | 0.97 |
| PF21960 | RCF1-5-like_lid | RCF1/5-like, AAA+ ATPase lid domain | 160 | 191 | 0.93 |
| PF12169 | DNA_pol3_gamma3 | DNA polymerase III subunits gamma and tau domain III | 208 | 336 | 0.92 |
| PF13177 | DNA_pol3_delta2 | DNA polymerase III, delta subunit | 3 | 149 | 0.88 |
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 24 | 145 | 0.86 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 24 | 122 | 0.83 |
| PF13401 | AAA_22 | AAA domain | 23 | 127 | 0.64 |
| PF13173 | AAA_14 | AAA domain | 22 | 127 | 0.63 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF12169 | GO:0003887 | DNA-directed DNA polymerase activity | MF |
| PF13401 | GO:0016887 | ATP hydrolysis activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.58 | 0.65 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.