Protein Family IF09247

Metagenome Isolate
110 Members
38 Samples
104 Scaffolds
461.63 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_303628|Ga0466703_303628_4213_5781
Length
522 aa
Sequence
MAMQKLFKQGFFRNFGLWKNIFGFKGTSGLPAAFLLLPILIFSGAGAAYTQQRYPTGAILDKAAYNALPRKAPLATRAXXXXPEMVSLKRYAPLPGDQTEYGTCVAWASAYAARTISESIALNRNSQTETTRNVFSPVYIYRNIRPDDPECQRGAQIHWALDLMKDSGAVRMLEIERSVDFPRVDLSYYQESRRYPIADYVTLFSRDENSKTNLIVRTVKKSLVEGKPVIIGMNTPFSFMEAEGAWRPSESPDNYYGGHAMCVVGYDDNREGGAFEILNSWGRKWGNGGFIWIPYRAFQDFVMEGYEMIENLATYSDTVKFAGFARIEIEEAGSSSPAPLVFFPGAESPDPADTTAGFFKTAAPLRQGTEFRFVLGAAESAYVYAFAASQPQTGAEDHAGAAFSGAVYSPVQLFPQPGVSPLLNYSDSAVALPGEDKTLVLDNVPGMEYLVVLYAKQSLNILDIMRRFEKAEGTVNARLSAVIGENLLSVNTAADTGREAAFTAESSDAKTVAALVVAIDHR

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.9%
Kalotermitidae 33.3%
Unclassified 19.4%
Termopsidae 5.6%
Rhinotermitidae 2.8%

🌳 Taxonomy

Archaea 1
Bacteria 102
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
9 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
10 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
19 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_271103 3300042614 Bacteria 6967
2 Ga0466718_040875 3300042617 Bacteria 3844
3 Ga0466702_135558 3300042635 Bacteria 18963
4 Ga0466703_409249 3300042636 Unclassified 4246
5 Ga0466707_396443 3300042601 Bacteria 1547
6 Ga0466720_043964 3300042607 Bacteria 8445
7 Ga0466720_051080 3300042607 Bacteria 3265
8 Ga0466720_087053 3300042607 Bacteria 5202
9 Ga0466720_172250 3300042607 Bacteria 10718
10 Ga0466722_052247 3300042609 Bacteria 1939
11 AustNasuHG_c1000891 3300000089 Bacteria 10774
12 AustNasuHG_c1003212 3300000089 Bacteria 5900
13 JGI24695J34938_10001194 3300002450 Bacteria 23018
14 JGI24695J34938_10005682 3300002450 Bacteria 7700
15 Ga0068302_10199862 3300005071 Bacteria 2526
16 Ga0072941_1004232 3300005201 Bacteria 14640
17 Ga0466712_016835 3300042614 Archaea 3667
18 Ga0466718_016001 3300042617 Unclassified 2865
19 Ga0466718_045056 3300042617 Bacteria 11672
20 Ga0466708_219903 3300042652 Bacteria 33244
21 Ga0466696_421546 3300042596 Bacteria 28748
22 Ga0466699_092447 3300042597 Bacteria 42528
23 Ga0466720_059006 3300042607 Bacteria 7710
24 Ga0466720_087496 3300042607 Bacteria 12622
25 Ga0466720_112824 3300042607 Bacteria 9572
26 AustNasuHG_c1018430 3300000089 Bacteria 2304
27 JGI24695J34938_10000632 3300002450 Bacteria 33543
28 JGI24695J34938_10001068 3300002450 Bacteria 24786
29 Ga0466705_050150 3300042612 Bacteria 30586
30 Ga0466718_092897 3300042617 Bacteria 10704
31 Ga0123356_10002586 3300010049 Bacteria 19291
32 Ga0123356_10016944 3300010049 Bacteria 6939
33 Ga0123356_10114074 3300010049 Bacteria 2615
34 Ga0466703_164835 3300042636 Bacteria 3269
35 Ga0466703_169741 3300042636 Bacteria 11654
36 Ga0466703_220039 3300042636 Bacteria 4690
37 Ga0466703_303628 3300042636 Bacteria 9928
38 Ga0466709_147502 3300042648 Unclassified 2950
39 Ga0466696_180132 3300042596 Bacteria 2181
40 Ga0466720_005981 3300042607 Bacteria 6068
41 Ga0466722_259532 3300042609 Bacteria 2213
42 JGI24698J34947_10003168 3300002449 Bacteria 8906
43 JGI24695J34938_10026392 3300002450 Bacteria 2761
44 Ga0466705_287503 3300042612 Bacteria 9145
45 Ga0466718_119080 3300042617 Bacteria 2462
46 Ga0123356_10001954 3300010049 Bacteria 22316
47 Ga0466708_276885 3300042652 Bacteria 2052
48 Ga0466691_087711 3300042593 Bacteria 4953
49 Ga0466694_266228 3300042594 Bacteria 7604
50 Ga0466699_211009 3300042597 Bacteria 48420
51 Ga0466699_318736 3300042597 Bacteria 6134
52 Ga0466720_006714 3300042607 Bacteria 7145
53 Ga0466720_150298 3300042607 Bacteria 2400
54 Ga0466720_155383 3300042607 Bacteria 2378
55 Ga0072940_1062762 3300005200 Bacteria 7066
56 Ga0072941_1084932 3300005201 Bacteria 2146
57 Ga0466728_222053 3300042620 Unclassified 3029
58 Ga0466704_141383 3300042643 Bacteria 4372
59 Ga0466704_433789 3300042643 Bacteria 54851
60 Ga0466709_368277 3300042648 Bacteria 2808
61 Ga0466708_192114 3300042652 Unclassified 3361
62 Ga0466699_170740 3300042597 Bacteria 35644
63 Ga0466719_024195 3300042606 Bacteria 4717
64 Ga0466719_376908 3300042606 Bacteria 2773
65 JGI24698J34947_10020764 3300002449 Bacteria 3536
66 JGI24695J34938_10000294 3300002450 Bacteria 49200
67 JGI24695J34938_10001085 3300002450 Bacteria 24581
68 Ga0466711_135447 3300042615 Bacteria 3692
69 Ga0466718_017209 3300042617 Bacteria 2940
70 Ga0466723_003985 3300042618 Unclassified 1791
71 Ga0466703_040924 3300042636 Bacteria 12128
72 Ga0466704_095731 3300042643 Bacteria 6436
73 Ga0466709_003306 3300042648 Bacteria 12751
74 Ga0466727_089165 3300042655 Bacteria 1591
75 Ga0264413_101471 3300024493 Bacteria 49537
76 Ga0466693_147270 3300042592 Bacteria 11696
77 Ga0466699_002401 3300042597 Bacteria 74503
78 Ga0466699_055351 3300042597 Bacteria 5101
79 Ga0466699_246316 3300042597 Bacteria 1828
80 Ga0466720_118229 3300042607 Bacteria 2218
81 Ga0072940_1045244 3300005200 Bacteria 5193
82 Ga0072940_1121330 3300005200 Bacteria 3797
83 Ga0466732_051479 3300042656 Bacteria 2400
84 Ga0466705_391799 3300042612 Bacteria 4813
85 Ga0466712_144716 3300042614 Bacteria 5499
86 Ga0466715_285840 3300042616 Bacteria 21443
87 Ga0123356_10000344 3300010049 Bacteria 53657
88 Ga0123353_10118887 3300010167 Bacteria 4250
89 Ga0466709_285973 3300042648 Bacteria 3128
90 Ga0466699_252562 3300042597 Bacteria 9165
91 JGI24695J34938_10001656 3300002450 Bacteria 18523
92 JGI24695J34938_10002412 3300002450 Bacteria 14335
93 Ga0466705_196375 3300042612 Bacteria 6146
94 Ga0466711_140332 3300042615 Bacteria 8972
95 Ga0466709_036205 3300042648 Bacteria 1755
96 Ga0466709_308989 3300042648 Bacteria 13963
97 Ga0466691_081052 3300042593 Bacteria 6669
98 Ga0466691_115889 3300042593 Bacteria 21188
99 Ga0466694_002749 3300042594 Bacteria 3102
100 Ga0466699_138737 3300042597 Bacteria 2462
101 Ga0466720_008712 3300042607 Bacteria 2123
102 AustNasuHG_c1008625 3300000089 Bacteria 3607
103 AustNasuHG_c1017766 3300000089 Bacteria 2359
104 JGI24695J34938_10010379 3300002450 Unclassified 5101

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_252562 Ga0466699_252562_7349_8761 419
2 3300042636 Ga0466703_040924 Ga0466703_040924_10840_12111 423
3 3300042597 Ga0466699_211009 Ga0466699_211009_2467_3897 425
4 3300000089 AustNasuHG_c1008625 AustNasuHG_10086253 433
5 3300042597 Ga0466699_138737 Ga0466699_138737_795_2198 433
6 3300042652 Ga0466708_276885 Ga0466708_276885_347_1768 434
7 3300042593 Ga0466691_081052 Ga0466691_081052_3980_5422 435
8 3300042597 Ga0466699_170740 Ga0466699_170740_31841_33229 435
9 3300042597 Ga0466699_318736 Ga0466699_318736_670_2064 435
10 3300005201 Ga0072941_1004232 Ga0072941_100423211 440
11 3300042594 Ga0466694_002749 Ga0466694_002749_1030_2451 441
12 3300000089 AustNasuHG_c1003212 AustNasuHG_10032123 442
13 3300042597 Ga0466699_246316 Ga0466699_246316_31_1428 444
14 3300042607 Ga0466720_059006 Ga0466720_059006_2821_4236 444
15 3300042606 Ga0466719_024195 Ga0466719_024195_564_1991 445
16 3300042606 Ga0466719_376908 Ga0466719_376908_235_1680 445
17 3300042607 Ga0466720_118229 Ga0466720_118229_189_1607 446
18 3300042648 Ga0466709_368277 Ga0466709_368277_176_1585 446
19 3300042648 Ga0466709_036205 Ga0466709_036205_195_1640 447
20 3300042607 Ga0466720_008712 Ga0466720_008712_310_1740 449
21 3300042607 Ga0466720_087496 Ga0466720_087496_7411_8829 449
22 3300042617 Ga0466718_016001 Ga0466718_016001_1122_2537 449
23 3300042648 Ga0466709_285973 Ga0466709_285973_650_2092 449
24 3300000089 AustNasuHG_c1018430 AustNasuHG_10184302 450
25 3300042607 Ga0466720_150298 Ga0466720_150298_235_1653 450
26 3300042614 Ga0466712_016835 Ga0466712_016835_1785_3191 450
27 3300042617 Ga0466718_017209 Ga0466718_017209_1102_2517 450
28 3300042607 Ga0466720_005981 Ga0466720_005981_4356_5777 453
29 3300042614 Ga0466712_144716 Ga0466712_144716_4053_5471 453
30 3300042596 Ga0466696_180132 Ga0466696_180132_568_2028 454
31 3300042612 Ga0466705_050150 Ga0466705_050150_5585_7015 454
32 3300000089 AustNasuHG_c1000891 AustNasuHG_10008913 456
33 3300042612 Ga0466705_287503 Ga0466705_287503_548_1987 456
34 3300010049 Ga0123356_10000344 Ga0123356_100003444 457
35 3300042617 Ga0466718_045056 Ga0466718_045056_7358_8767 457
36 3300005201 Ga0072941_1084932 Ga0072941_10849321 458
37 3300042652 Ga0466708_219903 Ga0466708_219903_6870_8309 458
38 3300005071 Ga0068302_10199862 Ga0068302_101998624 459
39 3300010049 Ga0123356_10114074 Ga0123356_101140743 459
40 3300042592 Ga0466693_147270 Ga0466693_147270_5903_7282 459
41 3300042597 Ga0466699_002401 Ga0466699_002401_64024_65442 459
42 3300042597 Ga0466699_055351 Ga0466699_055351_2737_4143 459
43 3300042648 Ga0466709_147502 Ga0466709_147502_470_1915 459
44 3300042607 Ga0466720_112824 Ga0466720_112824_4228_5658 460
45 3300042612 Ga0466705_391799 Ga0466705_391799_3047_4462 460
46 3300042617 Ga0466718_092897 Ga0466718_092897_2409_3821 460
47 3300005200 Ga0072940_1121330 Ga0072940_11213302 462
48 3300042597 Ga0466699_092447 Ga0466699_092447_37928_39316 462
49 3300024493 Ga0264413_101471 Ga0264413_1014718 463
50 3300042614 Ga0466712_271103 Ga0466712_271103_91_1482 463
51 iso_pr_bacteria 2781125650 2781308869 463
52 3300002450 JGI24695J34938_10001068 JGI24695J34938_100010684 464
53 3300002450 JGI24695J34938_10001656 JGI24695J34938_100016563 464
54 3300042609 Ga0466722_052247 Ga0466722_052247_471_1922 465
55 3300002449 JGI24698J34947_10003168 JGI24698J34947_100031688 466
56 3300002449 JGI24698J34947_10020764 JGI24698J34947_100207643 466
57 3300042593 Ga0466691_087711 Ga0466691_087711_1790_3235 466
58 3300042607 Ga0466720_155383 Ga0466720_155383_501_1919 466
59 3300042620 Ga0466728_222053 Ga0466728_222053_1422_2822 466
60 3300005200 Ga0072940_1062762 Ga0072940_10627624 467
61 3300010049 Ga0123356_10016944 Ga0123356_100169442 467
62 3300042593 Ga0466691_115889 Ga0466691_115889_17647_19050 467
63 3300042612 Ga0466705_196375 Ga0466705_196375_4173_5576 467
64 3300042618 Ga0466723_003985 Ga0466723_003985_192_1595 467
65 3300042643 Ga0466704_141383 Ga0466704_141383_2303_3706 467
66 3300042643 Ga0466704_433789 Ga0466704_433789_21310_22713 467
67 3300042648 Ga0466709_308989 Ga0466709_308989_7205_8608 467
68 3300042652 Ga0466708_192114 Ga0466708_192114_1155_2558 467
69 3300002450 JGI24695J34938_10001085 JGI24695J34938_1000108526 468
70 3300042636 Ga0466703_220039 Ga0466703_220039_249_1706 468
71 iso_pr_bacteria 2781125643 2781294155 468
72 iso_pr_bacteria 2781125657 2781324236 468
73 3300010049 Ga0123356_10002586 Ga0123356_100025863 469
74 3300042607 Ga0466720_043964 Ga0466720_043964_6995_8404 469
75 3300002450 JGI24695J34938_10002412 JGI24695J34938_100024124 470
76 3300042596 Ga0466696_421546 Ga0466696_421546_16108_17547 470
77 3300042609 Ga0466722_259532 Ga0466722_259532_100_1536 470
78 3300042615 Ga0466711_135447 Ga0466711_135447_1183_2673 470
79 iso_pr_bacteria 2781125634 2781275045 470
80 iso_pr_bacteria 2781125637 2781281359 470
81 iso_pr_bacteria 2781125649 2781306239 470
82 3300002450 JGI24695J34938_10000632 JGI24695J34938_1000063227 471
83 3300002450 JGI24695J34938_10001194 JGI24695J34938_1000119421 471
84 3300002450 JGI24695J34938_10010379 JGI24695J34938_100103791 471
85 3300042601 Ga0466707_396443 Ga0466707_396443_108_1523 471
86 3300042635 Ga0466702_135558 Ga0466702_135558_16753_18168 471
87 3300000089 AustNasuHG_c1017766 AustNasuHG_10177662 472
88 3300002450 JGI24695J34938_10005682 JGI24695J34938_100056828 472
89 3300002450 JGI24695J34938_10026392 JGI24695J34938_100263922 472
90 3300005200 Ga0072940_1045244 Ga0072940_10452441 472
91 3300042607 Ga0466720_051080 Ga0466720_051080_646_2064 472
92 3300042607 Ga0466720_087053 Ga0466720_087053_313_1731 472
93 3300042607 Ga0466720_172250 Ga0466720_172250_1544_2962 472
94 3300010167 Ga0123353_10118887 Ga0123353_101188873 473
95 3300042616 Ga0466715_285840 Ga0466715_285840_17855_19276 473
96 3300042617 Ga0466718_119080 Ga0466718_119080_321_1742 473
97 3300042594 Ga0466694_266228 Ga0466694_266228_1421_2845 474
98 3300042617 Ga0466718_040875 Ga0466718_040875_853_2277 474
99 3300002450 JGI24695J34938_10000294 JGI24695J34938_1000029440 476
100 3300042615 Ga0466711_140332 Ga0466711_140332_2158_3588 476
101 3300042648 Ga0466709_003306 Ga0466709_003306_8225_9658 477
102 3300042656 Ga0466732_051479 Ga0466732_051479_411_1850 479
103 3300042607 Ga0466720_006714 Ga0466720_006714_2212_3654 480
104 3300042636 Ga0466703_409249 Ga0466703_409249_121_1563 480
105 3300042643 Ga0466704_095731 Ga0466704_095731_894_2336 480
106 3300042636 Ga0466703_169741 Ga0466703_169741_4090_5601 481
107 3300042655 Ga0466727_089165 Ga0466727_089165_126_1580 484
108 3300010049 Ga0123356_10001954 Ga0123356_100019548 486
109 3300042636 Ga0466703_164835 Ga0466703_164835_187_1674 495
110 3300042636 Ga0466703_303628 Ga0466703_303628_4213_5781 522

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13529 Peptidase_C39_2 Peptidase_C39 like family 194 270 0.84
PF00112 Peptidase_C1 Papain family cysteine protease 213 294 0.7

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.