Protein Family IF09242

Metagenome Isolate
103 Members
33 Samples
99 Scaffolds
339.82 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_293135|Ga0466703_293135_997_2124
Length
375 aa
Sequence
MEYSHKFFTKFDKINCFHIDKRQGNGENQGMPPRVIDIAKVAEVSPAAVSLALNNKTGVSDKVRRKILGIATQMGYKNSFPEQFAVNENITIRLLKIAKHGHIVNDWHNAFITEYLEGIEPEVKKRKYKLEVSFFNRIPVEEIIKSQADARIDGFIVLGTELNDHELVFFKTLKKPVVFIDTYFPLSVYDCVDMDNVDGVFKAIEHLYKAGHRSIGLVKSSYESRNFRMREFGFKEAMGYFSLPVQEKFIINVDPTVDGSLRDMSKYLDKNRNLPTAFFCMNDIISYGVIKALRGYEFSIPKDLSIIGFDDLPSSSISEPPLTSIRVSTQRIGGRALEKLAERISSEKFPNAPLHVPENILISGKLVVRDSVRQI

πŸ“Š Sample Types

Isolate 3.9%
Metagenome 96.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 42.4%
Termitidae 21.2%
Termopsidae 12.1%
Unclassified 9.1%
Rhinotermitidae 9.1%
Hodotermitidae 3.0%
Blaberidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 98
Eukaryota 0
Viruses 1
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
6 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2772190975 Treponema sp. RmG30 Isolate Blaberidae
33 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_220755 3300042612 Bacteria 12088
2 JGI24702J35022_10001825 3300002462 Bacteria 13115
3 Ga0466691_133409 3300042593 Bacteria 6759
4 Ga0466699_166177 3300042597 Bacteria 1601
5 Ga0466703_046670 3300042636 Bacteria 19297
6 Ga0466704_119801 3300042643 Bacteria 3254
7 Ga0466704_317291 3300042643 Bacteria 6423
8 Ga0466709_151000 3300042648 Bacteria 7539
9 Ga0466727_181819 3300042655 Bacteria 1309
10 Ga0466707_090556 3300042601 Bacteria 1322
11 Ga0466707_247561 3300042601 Bacteria 6511
12 Ga0466716_144240 3300042605 Bacteria 2482
13 Ga0466722_227841 3300042609 Bacteria 2685
14 Ga0466711_203726 3300042615 Bacteria 10162
15 Ga0466711_273257 3300042615 Bacteria 9772
16 Ga0466715_478584 3300042616 Bacteria 2959
17 Ga0466715_487464 3300042616 Bacteria 27818
18 Ga0466723_131317 3300042618 Bacteria 1350
19 Ga0466705_085627 3300042612 Bacteria 6848
20 Ga0466705_200508 3300042612 Bacteria 16313
21 Ga0466705_240125 3300042612 Bacteria 4854
22 Ga0466705_280296 3300042612 Bacteria 1971
23 Ga0466691_107496 3300042593 Bacteria 7546
24 Ga0466729_303659 3300042621 Bacteria 1282
25 Ga0466704_015121 3300042643 Bacteria 12524
26 Ga0466708_169204 3300042652 Bacteria 12457
27 Ga0466726_182724 3300042619 Bacteria 1573
28 Ga0466705_101661 3300042612 Bacteria 6180
29 Ga0466696_036556 3300042596 Bacteria 7649
30 Ga0466696_323589 3300042596 Bacteria 3336
31 Ga0466703_022881 3300042636 Bacteria 15863
32 Ga0466703_176579 3300042636 Bacteria 1627
33 Ga0466703_249685 3300042636 Unclassified 4642
34 Ga0466704_010142 3300042643 Bacteria 37386
35 Ga0466704_072509 3300042643 Bacteria 8333
36 Ga0466704_090667 3300042643 Bacteria 35181
37 Ga0466704_130556 3300042643 Bacteria 2180
38 Ga0466704_134642 3300042643 Bacteria 11244
39 Ga0466716_239660 3300042605 Bacteria 1502
40 Ga0466719_052834 3300042606 Bacteria 1239
41 Ga0466719_075975 3300042606 Bacteria 19116
42 Ga0466711_363685 3300042615 Bacteria 11257
43 Ga0466723_116221 3300042618 Bacteria 1170
44 Ga0466723_148283 3300042618 Bacteria 4664
45 Ga0466732_061506 3300042656 Bacteria 6093
46 Ga0466733_197965 3300042659 Bacteria 1354
47 Ga0466691_047758 3300042593 Bacteria 4042
48 Ga0466703_293135 3300042636 Bacteria 2166
49 Ga0466704_091012 3300042643 Bacteria 4283
50 Ga0466709_273049 3300042648 Bacteria 12674
51 Ga0466708_068735 3300042652 Bacteria 9367
52 Ga0466708_102752 3300042652 Bacteria 1679
53 Ga0466708_126027 3300042652 Bacteria 1715
54 Ga0466716_518800 3300042605 Bacteria 2815
55 Ga0466715_072439 3300042616 Bacteria 8295
56 Ga0466715_531247 3300042616 Bacteria 26607
57 Ga0466726_244159 3300042619 Bacteria 7249
58 Ga0466705_329392 3300042612 Bacteria 2141
59 Ga0466690_082340 3300042590 Bacteria 17875
60 Ga0466690_308423 3300042590 Bacteria 2785
61 Ga0466692_106162 3300042591 Bacteria 2293
62 Ga0466735_104101 3300042624 Bacteria 2466
63 Ga0466704_041711 3300042643 Bacteria 1544
64 Ga0466709_110288 3300042648 Bacteria 3774
65 Ga0466707_071779 3300042601 Bacteria 1665
66 Ga0466722_148759 3300042609 Bacteria 1929
67 Ga0466712_003483 3300042614 Unclassified 4330
68 Ga0466711_139034 3300042615 Bacteria 1298
69 Ga0466711_360839 3300042615 Bacteria 1508
70 Ga0466711_395758 3300042615 Bacteria 15247
71 JGI24698J34947_10000449 3300002449 Bacteria 19083
72 Ga0466703_082358 3300042636 Bacteria 42973
73 Ga0466704_379707 3300042643 Bacteria 13287
74 Ga0466709_123694 3300042648 Bacteria 1198
75 Ga0466727_170824 3300042655 Bacteria 1061
76 Ga0466716_433450 3300042605 Unclassified 2423
77 Ga0466705_483374 3300042612 Bacteria 2685
78 Ga0466715_027672 3300042616 Bacteria 2166
79 Ga0466729_032163 3300042621 Bacteria 2458
80 Ga0466732_033440 3300042656 Bacteria 3352
81 Ga0466733_082158 3300042659 Bacteria 1867
82 Ga0466703_017531 3300042636 Bacteria 40981
83 Ga0466706_029719 3300042599 Bacteria 11555
84 Ga0466728_056372 3300042620 Bacteria 7136
85 Ga0466705_221957 3300042612 Bacteria 2034
86 JGI24698J34947_10001729 3300002449 Bacteria 11640
87 Ga0068302_10611902 3300005071 Viruses 1373
88 Ga0123354_10099391 3300010882 Unclassified 3947
89 Ga0466690_220626 3300042590 Bacteria 2412
90 Ga0466691_006534 3300042593 Bacteria 2190
91 Ga0466708_074878 3300042652 Bacteria 6617
92 Ga0466708_142961 3300042652 Bacteria 40996
93 Ga0466722_202153 3300042609 Bacteria 3481
94 Ga0466711_006644 3300042615 Bacteria 10600
95 Ga0466711_200323 3300042615 Bacteria 39261
96 Ga0466711_334480 3300042615 Bacteria 9884
97 Ga0466715_091879 3300042616 Bacteria 83726
98 Ga0466715_129769 3300042616 Bacteria 23014
99 Ga0466723_123470 3300042618 Bacteria 1769

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_082340 Ga0466690_082340_4141_5172 320
2 3300042612 Ga0466705_220755 Ga0466705_220755_10077_11099 321
3 3300042655 Ga0466727_170824 Ga0466727_170824_85_1050 321
4 3300042648 Ga0466709_273049 Ga0466709_273049_309_1325 328
5 3300002462 JGI24702J35022_10001825 JGI24702J35022_100018257 330
6 3300042659 Ga0466733_197965 Ga0466733_197965_83_1075 330
7 3300042591 Ga0466692_106162 Ga0466692_106162_10_1047 336
8 3300042618 Ga0466723_123470 Ga0466723_123470_510_1520 336
9 3300042605 Ga0466716_239660 Ga0466716_239660_429_1442 337
10 3300042612 Ga0466705_221957 Ga0466705_221957_319_1332 337
11 3300042643 Ga0466704_090667 Ga0466704_090667_15199_16212 337
12 3300042652 Ga0466708_074878 Ga0466708_074878_3481_4494 337
13 3300042593 Ga0466691_133409 Ga0466691_133409_349_1365 338
14 3300042601 Ga0466707_090556 Ga0466707_090556_99_1115 338
15 3300042605 Ga0466716_433450 Ga0466716_433450_1076_2092 338
16 3300042615 Ga0466711_006644 Ga0466711_006644_4510_5526 338
17 3300042616 Ga0466715_027672 Ga0466715_027672_595_1611 338
18 3300042624 Ga0466735_104101 Ga0466735_104101_763_1779 338
19 3300042643 Ga0466704_130556 Ga0466704_130556_390_1406 338
20 3300042648 Ga0466709_110288 Ga0466709_110288_1378_2394 338
21 3300042652 Ga0466708_102752 Ga0466708_102752_177_1193 338
22 3300042652 Ga0466708_142961 Ga0466708_142961_21260_22276 338
23 3300042652 Ga0466708_169204 Ga0466708_169204_2840_3856 338
24 3300042596 Ga0466696_036556 Ga0466696_036556_2699_3718 339
25 3300042596 Ga0466696_323589 Ga0466696_323589_1941_2960 339
26 3300042601 Ga0466707_247561 Ga0466707_247561_1532_2551 339
27 3300042605 Ga0466716_518800 Ga0466716_518800_381_1400 339
28 3300042612 Ga0466705_329392 Ga0466705_329392_82_1101 339
29 3300042615 Ga0466711_273257 Ga0466711_273257_3590_4609 339
30 3300042616 Ga0466715_091879 Ga0466715_091879_16752_17771 339
31 3300042616 Ga0466715_129769 Ga0466715_129769_6851_7870 339
32 3300042616 Ga0466715_531247 Ga0466715_531247_6860_7879 339
33 3300042620 Ga0466728_056372 Ga0466728_056372_6002_7021 339
34 3300042636 Ga0466703_017531 Ga0466703_017531_12717_13736 339
35 3300042636 Ga0466703_046670 Ga0466703_046670_16152_17171 339
36 3300042643 Ga0466704_010142 Ga0466704_010142_5685_6704 339
37 3300042648 Ga0466709_123694 Ga0466709_123694_98_1117 339
38 3300042652 Ga0466708_068735 Ga0466708_068735_6915_7934 339
39 3300005071 Ga0068302_10611902 Ga0068302_106119021 340
40 3300042593 Ga0466691_006534 Ga0466691_006534_357_1379 340
41 3300042597 Ga0466699_166177 Ga0466699_166177_85_1107 340
42 3300042601 Ga0466707_071779 Ga0466707_071779_112_1134 340
43 3300042605 Ga0466716_144240 Ga0466716_144240_1074_2096 340
44 3300042606 Ga0466719_052834 Ga0466719_052834_11_1033 340
45 3300042609 Ga0466722_227841 Ga0466722_227841_642_1664 340
46 3300042612 Ga0466705_483374 Ga0466705_483374_1643_2665 340
47 3300042614 Ga0466712_003483 Ga0466712_003483_2501_3523 340
48 3300042615 Ga0466711_139034 Ga0466711_139034_262_1284 340
49 3300042615 Ga0466711_200323 Ga0466711_200323_29808_30830 340
50 3300042615 Ga0466711_334480 Ga0466711_334480_1183_2205 340
51 3300042615 Ga0466711_363685 Ga0466711_363685_9163_10185 340
52 3300042615 Ga0466711_395758 Ga0466711_395758_7403_8425 340
53 3300042616 Ga0466715_487464 Ga0466715_487464_5838_6860 340
54 3300042618 Ga0466723_131317 Ga0466723_131317_158_1180 340
55 3300042619 Ga0466726_244159 Ga0466726_244159_2283_3305 340
56 3300042621 Ga0466729_032163 Ga0466729_032163_59_1081 340
57 3300042636 Ga0466703_249685 Ga0466703_249685_1497_2519 340
58 3300042643 Ga0466704_015121 Ga0466704_015121_8708_9730 340
59 3300042643 Ga0466704_041711 Ga0466704_041711_119_1141 340
60 3300042643 Ga0466704_317291 Ga0466704_317291_982_2004 340
61 3300042652 Ga0466708_126027 Ga0466708_126027_128_1150 340
62 3300042656 Ga0466732_033440 Ga0466732_033440_1801_2823 340
63 3300042659 Ga0466733_082158 Ga0466733_082158_193_1215 340
64 iso_pr_bacteria 2772190975 2773721582 340
65 iso_pr_bacteria 650716099 650877474 340
66 iso_pr_bacteria 650716099 650877949 340
67 3300002449 JGI24698J34947_10000449 JGI24698J34947_1000044914 341
68 3300002449 JGI24698J34947_10001729 JGI24698J34947_100017296 341
69 3300042590 Ga0466690_308423 Ga0466690_308423_614_1639 341
70 3300042593 Ga0466691_047758 Ga0466691_047758_338_1363 341
71 3300042593 Ga0466691_107496 Ga0466691_107496_1153_2178 341
72 3300042606 Ga0466719_075975 Ga0466719_075975_15764_16789 341
73 3300042609 Ga0466722_202153 Ga0466722_202153_284_1309 341
74 3300042612 Ga0466705_200508 Ga0466705_200508_6076_7101 341
75 3300042612 Ga0466705_240125 Ga0466705_240125_3559_4584 341
76 3300042612 Ga0466705_280296 Ga0466705_280296_14_1039 341
77 3300042616 Ga0466715_072439 Ga0466715_072439_2055_3080 341
78 3300042618 Ga0466723_116221 Ga0466723_116221_92_1117 341
79 3300042619 Ga0466726_182724 Ga0466726_182724_51_1076 341
80 3300042643 Ga0466704_072509 Ga0466704_072509_4941_5966 341
81 3300042643 Ga0466704_091012 Ga0466704_091012_1143_2168 341
82 3300042655 Ga0466727_181819 Ga0466727_181819_86_1111 341
83 iso_pr_bacteria 2781125687 2781421307 341
84 3300010882 Ga0123354_10099391 Ga0123354_100993913 342
85 3300042590 Ga0466690_220626 Ga0466690_220626_589_1617 342
86 3300042612 Ga0466705_085627 Ga0466705_085627_299_1327 342
87 3300042615 Ga0466711_203726 Ga0466711_203726_1238_2266 342
88 3300042618 Ga0466723_148283 Ga0466723_148283_3309_4337 342
89 3300042636 Ga0466703_022881 Ga0466703_022881_14081_15109 342
90 3300042636 Ga0466703_082358 Ga0466703_082358_6919_7947 342
91 3300042643 Ga0466704_134642 Ga0466704_134642_872_1900 342
92 3300042648 Ga0466709_151000 Ga0466709_151000_885_1913 342
93 3300042599 Ga0466706_029719 Ga0466706_029719_6255_7286 343
94 3300042615 Ga0466711_360839 Ga0466711_360839_137_1171 344
95 3300042616 Ga0466715_478584 Ga0466715_478584_1525_2562 345
96 3300042636 Ga0466703_176579 Ga0466703_176579_102_1184 345
97 3300042643 Ga0466704_379707 Ga0466704_379707_8504_9541 345
98 3300042656 Ga0466732_061506 Ga0466732_061506_715_1752 345
99 3300042609 Ga0466722_148759 Ga0466722_148759_461_1501 346
100 3300042612 Ga0466705_101661 Ga0466705_101661_313_1353 346
101 3300042621 Ga0466729_303659 Ga0466729_303659_69_1112 347
102 3300042643 Ga0466704_119801 Ga0466704_119801_968_2026 352
103 3300042636 Ga0466703_293135 Ga0466703_293135_997_2124 375

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00356 LacI Bacterial regulatory proteins, lacI family 37 77 0.97
PF13377 Peripla_BP_3 Periplasmic binding protein-like domain 204 372 0.92
PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family 143 364 0.84
PF13407 Peripla_BP_4 Periplasmic binding protein domain 103 313 0.83

πŸ—οΈ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3clk-assembly1.cif.gz_B Crystal structure of a transcription regulator from Lactobacillus plantarum 0.894 90 375
1jyf-assembly1.cif.gz_A Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion. 0.878 90 373
1sxg-assembly3.cif.gz_F Structural studies on the apo transcription factor form B. megaterium 0.873 90 373
3k9c-assembly1.cif.gz_A Crystal structure of LacI Transcriptional regulator from Rhodococcus species. 0.87 91 374
4rzt-assembly1.cif.gz_A Lac repressor engineered to bind sucralose, sucralose-bound tetramer 0.869 90 374
IDDescriptionScoreStartEndSuperfamily
3huuA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9244 195 324 3.40.50.2300
1jhzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9171 197 324 3.40.50.2300
3kkeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9095 197 324 3.40.50.2300
3oqnC01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9081 31 79 1.10.260.40
2keiB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9069 35 76 1.10.260.40
IDDescriptionScoreStartEndGO Terms
AF-A0A7Z7PUY8-F1-model_v4 Uncharacterized/unreviewed 0.9453 162 375
AF-A0A5C4M5S3-F1-model_v4 Uncharacterized/unreviewed 0.9266 176 375 GO:0003700
GO:0000976
AF-A0A380DNH3-F1-model_v4 Uncharacterized/unreviewed 0.9158 178 375 GO:0003700
GO:0000976

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.