Protein Family IF09238
Metagenome
Isolate
158
Members
62
Samples
133
Scaffolds
308.4
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_289947|Ga0466703_289947_8283_9302
- Length
- 339 aa
- Sequence
- MPGVITAVIWDRKAVNRVKMKIHDFMRKVIGIGETVLDIIFQGDQPHAAVPGGSVFNGMVSLSRLGIPVTFVSELGNDRVGEMVCRFMRENGMTTDYMDVHPEGKTPVSLAFLSEQKNAEYLFYTGYPDRRSEMACPPVNEDDIFIFGSFYALDPRIRPWIVELLEYARQRKAIIYYDPNFRKIHTHKAIHVRSTVMDNYEYADLVRGSDEDFLNLYDRTDMDAVYRDEVHYYCKTLITTHGANGVRLFTDNLRLHFDVSAVTPVSTVGAGDNFNAGIIYGLLKQGVGRRDLPGLHAEAWKHIIRSGMELSAEVCLSYANYIPIDFAEKFSQRYSELKL
Sample Types
Isolate
15.8%
Metagenome
84.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.9%
Kalotermitidae
22.6%
Termitidae
14.5%
Unclassified
9.7%
Termopsidae
6.5%
Rhinotermitidae
6.5%
Passalidae
4.8%
Hodotermitidae
1.6%
Taxonomy
Archaea
1
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 15 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 16 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 17 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 18 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 32 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 33 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 38 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 39 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 40 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 48 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 49 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 50 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 51 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 52 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 58 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_030815 | 3300042659 | Bacteria | 19476 |
| 2 | Ga0466711_180497 | 3300042615 | Bacteria | 4432 |
| 3 | Ga0466690_091124 | 3300042590 | Bacteria | 36086 |
| 4 | Ga0466701_013027 | 3300042598 | Bacteria | 25926 |
| 5 | Ga0466707_283130 | 3300042601 | Bacteria | 2679 |
| 6 | Ga0466735_084064 | 3300042624 | Unclassified | 1088 |
| 7 | Ga0466704_065755 | 3300042643 | Bacteria | 13761 |
| 8 | Ga0466704_407394 | 3300042643 | Bacteria | 14777 |
| 9 | Ga0466709_376503 | 3300042648 | Bacteria | 12791 |
| 10 | Ga0466727_095967 | 3300042655 | Bacteria | 3008 |
| 11 | IMNBL1DRAFT_c0000738 | 3300000062 | Bacteria | 25952 |
| 12 | JGI24705J35276_12238629 | 3300002504 | Bacteria | 30352 |
| 13 | JGI24699J35502_11133926 | 3300002509 | Bacteria | 19671 |
| 14 | Ga0068302_10044851 | 3300005071 | Bacteria | 4237 |
| 15 | Ga0068305_10026750 | 3300005083 | Bacteria | 10368 |
| 16 | Ga0466732_148619 | 3300042656 | Bacteria | 3716 |
| 17 | Ga0123354_10027610 | 3300010882 | Bacteria | 8941 |
| 18 | Ga0466711_443540 | 3300042615 | Bacteria | 17011 |
| 19 | Ga0466726_079860 | 3300042619 | Unclassified | 5219 |
| 20 | Ga0466729_083064 | 3300042621 | Bacteria | 1569 |
| 21 | Ga0466692_097654 | 3300042591 | Bacteria | 22801 |
| 22 | Ga0466691_016966 | 3300042593 | Bacteria | 13327 |
| 23 | Ga0466713_044431 | 3300042602 | Bacteria | 51121 |
| 24 | Ga0466735_043039 | 3300042624 | Bacteria | 1992 |
| 25 | Ga0466703_087510 | 3300042636 | Bacteria | 17341 |
| 26 | Ga0466704_372245 | 3300042643 | Bacteria | 13926 |
| 27 | Ga0466704_499087 | 3300042643 | Bacteria | 6995 |
| 28 | Ga0466704_582225 | 3300042643 | Bacteria | 53049 |
| 29 | Ga0466708_120576 | 3300042652 | Bacteria | 34134 |
| 30 | Ga0466708_307050 | 3300042652 | Bacteria | 51768 |
| 31 | Ga0466727_000978 | 3300042655 | Bacteria | 1432 |
| 32 | Ga0466727_047526 | 3300042655 | Bacteria | 13694 |
| 33 | Ga0466727_163836 | 3300042655 | Bacteria | 2337 |
| 34 | IMNBL1DRAFT_c0003452 | 3300000062 | Bacteria | 10153 |
| 35 | Ga0068302_10141120 | 3300005071 | Unclassified | 2690 |
| 36 | Ga0068302_10144470 | 3300005071 | Bacteria | 3342 |
| 37 | Ga0466705_249448 | 3300042612 | Bacteria | 12035 |
| 38 | Ga0466711_328156 | 3300042615 | Bacteria | 9449 |
| 39 | Ga0466715_255108 | 3300042616 | Bacteria | 17635 |
| 40 | Ga0466707_415441 | 3300042601 | Bacteria | 4570 |
| 41 | Ga0466716_317309 | 3300042605 | Bacteria | 4899 |
| 42 | Ga0466719_299936 | 3300042606 | Bacteria | 4408 |
| 43 | Ga0466704_303500 | 3300042643 | Bacteria | 20207 |
| 44 | Ga0466727_041687 | 3300042655 | Bacteria | 11156 |
| 45 | JGI24702J35022_10083531 | 3300002462 | Bacteria | 1732 |
| 46 | Ga0068302_10208052 | 3300005071 | Bacteria | 1370 |
| 47 | Ga0466705_033023 | 3300042612 | Bacteria | 10482 |
| 48 | Ga0123357_10014370 | 3300009784 | Bacteria | 10330 |
| 49 | Ga0123354_10032871 | 3300010882 | Bacteria | 8125 |
| 50 | Ga0466726_112168 | 3300042619 | Bacteria | 3347 |
| 51 | Ga0466729_120951 | 3300042621 | Bacteria | 33674 |
| 52 | Ga0466690_198905 | 3300042590 | Bacteria | 12802 |
| 53 | Ga0466692_096905 | 3300042591 | Bacteria | 18961 |
| 54 | Ga0466713_085697 | 3300042602 | Bacteria | 7961 |
| 55 | Ga0466716_028430 | 3300042605 | Bacteria | 9140 |
| 56 | Ga0466716_410584 | 3300042605 | Bacteria | 58331 |
| 57 | Ga0466722_048206 | 3300042609 | Bacteria | 5022 |
| 58 | Ga0466704_479765 | 3300042643 | Bacteria | 17636 |
| 59 | Ga0466709_039622 | 3300042648 | Bacteria | 20117 |
| 60 | 2227175247 | 2225789004 | Bacteria | 8144 |
| 61 | IMNBL1DRAFT_c0013829 | 3300000062 | Bacteria | 3595 |
| 62 | Ga0068302_10191216 | 3300005071 | Bacteria | 3622 |
| 63 | Ga0466705_053356 | 3300042612 | Bacteria | 6242 |
| 64 | Ga0123357_10106272 | 3300009784 | Bacteria | 3599 |
| 65 | Ga0466711_286687 | 3300042615 | Bacteria | 10769 |
| 66 | Ga0466715_072088 | 3300042616 | Bacteria | 72248 |
| 67 | Ga0466723_258914 | 3300042618 | Bacteria | 2794 |
| 68 | Ga0466729_077417 | 3300042621 | Bacteria | 5055 |
| 69 | Ga0466706_021250 | 3300042599 | Bacteria | 1866 |
| 70 | Ga0466719_431354 | 3300042606 | Bacteria | 5137 |
| 71 | Ga0466722_015704 | 3300042609 | Bacteria | 71312 |
| 72 | Ga0466722_062477 | 3300042609 | Bacteria | 11403 |
| 73 | Ga0466709_275287 | 3300042648 | Archaea | 2043 |
| 74 | Ga0466708_381916 | 3300042652 | Bacteria | 41700 |
| 75 | 2227372472 | 2225789004 | Bacteria | 5996 |
| 76 | IMNBL1DRAFT_c0003754 | 3300000062 | Unclassified | 9510 |
| 77 | JGI24699J35502_11133360 | 3300002509 | Bacteria | 10095 |
| 78 | Ga0466733_111660 | 3300042659 | Bacteria | 47113 |
| 79 | Ga0123353_10195287 | 3300010167 | Bacteria | 3191 |
| 80 | Ga0466726_174689 | 3300042619 | Bacteria | 1177 |
| 81 | Ga0466692_100322 | 3300042591 | Bacteria | 97018 |
| 82 | Ga0466696_148581 | 3300042596 | Bacteria | 2093 |
| 83 | Ga0466706_163246 | 3300042599 | Bacteria | 60191 |
| 84 | Ga0466707_189165 | 3300042601 | Bacteria | 2075 |
| 85 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 86 | Ga0466719_568342 | 3300042606 | Bacteria | 2039 |
| 87 | Ga0466735_097839 | 3300042624 | Bacteria | 7071 |
| 88 | Ga0466703_021939 | 3300042636 | Bacteria | 9896 |
| 89 | Ga0466703_121629 | 3300042636 | Bacteria | 5016 |
| 90 | Ga0466704_406084 | 3300042643 | Bacteria | 4312 |
| 91 | Ga0466704_493757 | 3300042643 | Bacteria | 5631 |
| 92 | Ga0466727_151725 | 3300042655 | Bacteria | 4062 |
| 93 | Ga0466733_170460 | 3300042659 | Bacteria | 186955 |
| 94 | Ga0123357_10036635 | 3300009784 | Bacteria | 6675 |
| 95 | Ga0123357_10044020 | 3300009784 | Bacteria | 6062 |
| 96 | Ga0123354_10017849 | 3300010882 | Bacteria | 11118 |
| 97 | Ga0466711_007932 | 3300042615 | Bacteria | 16347 |
| 98 | Ga0466711_268980 | 3300042615 | Bacteria | 10316 |
| 99 | Ga0466711_287615 | 3300042615 | Bacteria | 2914 |
| 100 | Ga0466723_066496 | 3300042618 | Bacteria | 12360 |
| 101 | Ga0466726_049116 | 3300042619 | Bacteria | 5096 |
| 102 | Ga0466726_382645 | 3300042619 | Bacteria | 9872 |
| 103 | Ga0466690_039569 | 3300042590 | Bacteria | 2581 |
| 104 | Ga0466690_254356 | 3300042590 | Bacteria | 9443 |
| 105 | Ga0466692_008872 | 3300042591 | Bacteria | 29437 |
| 106 | Ga0466691_081100 | 3300042593 | Bacteria | 5406 |
| 107 | Ga0466696_001911 | 3300042596 | Bacteria | 82336 |
| 108 | Ga0466706_021733 | 3300042599 | Bacteria | 16070 |
| 109 | Ga0466706_069566 | 3300042599 | Bacteria | 24649 |
| 110 | Ga0466716_076910 | 3300042605 | Bacteria | 11677 |
| 111 | Ga0466716_387237 | 3300042605 | Bacteria | 17852 |
| 112 | Ga0466704_183723 | 3300042643 | Bacteria | 9904 |
| 113 | Ga0466727_246181 | 3300042655 | Bacteria | 1771 |
| 114 | 2226994264 | 2225789003 | Bacteria | 6763 |
| 115 | 2227480190 | 2225789004 | Bacteria | 22361 |
| 116 | Ga0068305_10004417 | 3300005083 | Bacteria | 55018 |
| 117 | Ga0123357_10308900 | 3300009784 | Bacteria | 1583 |
| 118 | Ga0123354_10072274 | 3300010882 | Bacteria | 4969 |
| 119 | Ga0466711_178822 | 3300042615 | Bacteria | 4432 |
| 120 | Ga0466711_400982 | 3300042615 | Bacteria | 5274 |
| 121 | Ga0466715_368612 | 3300042616 | Bacteria | 6621 |
| 122 | Ga0466728_055345 | 3300042620 | Bacteria | 34961 |
| 123 | Ga0466706_007761 | 3300042599 | Bacteria | 10451 |
| 124 | Ga0466707_164963 | 3300042601 | Bacteria | 15338 |
| 125 | Ga0466707_415511 | 3300042601 | Bacteria | 3191 |
| 126 | Ga0466722_071447 | 3300042609 | Bacteria | 21435 |
| 127 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 128 | Ga0466704_031820 | 3300042643 | Bacteria | 15160 |
| 129 | Ga0466704_036166 | 3300042643 | Bacteria | 1687 |
| 130 | Ga0466704_055943 | 3300042643 | Bacteria | 3851 |
| 131 | Ga0466727_225961 | 3300042655 | Bacteria | 24553 |
| 132 | IMNBL1DRAFT_c0002089 | 3300000062 | Bacteria | 14219 |
| 133 | Ga0068305_10143422 | 3300005083 | Bacteria | 6966 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_174689 | Ga0466726_174689_32_862 | 255 |
| 2 | 3300010167 | Ga0123353_10195287 | Ga0123353_101952872 | 277 |
| 3 | 3300042591 | Ga0466692_008872 | Ga0466692_008872_3657_4568 | 285 |
| 4 | 3300042648 | Ga0466709_275287 | Ga0466709_275287_1162_2022 | 286 |
| 5 | 3300000062 | IMNBL1DRAFT_c0002089 | IMNBL1DRAFT_000208914 | 288 |
| 6 | 3300042602 | Ga0466713_044431 | Ga0466713_044431_29776_30645 | 289 |
| 7 | 3300042618 | Ga0466723_066496 | Ga0466723_066496_6663_7559 | 298 |
| 8 | 2225789004 | 2227372472 | 2227818893 | 299 |
| 9 | 3300042624 | Ga0466735_043039 | Ga0466735_043039_131_1039 | 302 |
| 10 | 3300042643 | Ga0466704_499087 | Ga0466704_499087_3706_4614 | 302 |
| 11 | 3300042590 | Ga0466690_039569 | Ga0466690_039569_1444_2355 | 303 |
| 12 | 3300042615 | Ga0466711_400982 | Ga0466711_400982_3526_4437 | 303 |
| 13 | 3300042621 | Ga0466729_077417 | Ga0466729_077417_627_1538 | 303 |
| 14 | 3300042643 | Ga0466704_493757 | Ga0466704_493757_2262_3173 | 303 |
| 15 | 3300042601 | Ga0466707_283130 | Ga0466707_283130_1437_2351 | 304 |
| 16 | 3300042643 | Ga0466704_406084 | Ga0466704_406084_467_1381 | 304 |
| 17 | 3300042656 | Ga0466732_148619 | Ga0466732_148619_1652_2566 | 304 |
| 18 | 3300042619 | Ga0466726_079860 | Ga0466726_079860_1584_2501 | 305 |
| 19 | 3300042643 | Ga0466704_031820 | Ga0466704_031820_1191_2108 | 305 |
| 20 | 3300042655 | Ga0466727_151725 | Ga0466727_151725_1168_2085 | 305 |
| 21 | 3300009784 | Ga0123357_10014370 | Ga0123357_100143707 | 306 |
| 22 | 3300009784 | Ga0123357_10036635 | Ga0123357_100366353 | 306 |
| 23 | 3300009784 | Ga0123357_10044020 | Ga0123357_100440205 | 306 |
| 24 | 3300009784 | Ga0123357_10308900 | Ga0123357_103089002 | 306 |
| 25 | 3300010882 | Ga0123354_10017849 | Ga0123354_100178494 | 306 |
| 26 | 3300010882 | Ga0123354_10032871 | Ga0123354_100328716 | 306 |
| 27 | 3300010882 | Ga0123354_10072274 | Ga0123354_100722746 | 306 |
| 28 | 3300042591 | Ga0466692_097654 | Ga0466692_097654_6315_7235 | 306 |
| 29 | 3300042599 | Ga0466706_007761 | Ga0466706_007761_2949_3869 | 306 |
| 30 | 3300042599 | Ga0466706_163246 | Ga0466706_163246_38437_39357 | 306 |
| 31 | 3300042601 | Ga0466707_415511 | Ga0466707_415511_290_1210 | 306 |
| 32 | 3300042659 | Ga0466733_111660 | Ga0466733_111660_37822_38742 | 306 |
| 33 | iso_pr_bacteria | 2940199050 | 2940201167 | 306 |
| 34 | iso_pr_bacteria | 2940209341 | 2940209549 | 306 |
| 35 | iso_pr_bacteria | 2940346213 | 2940349383 | 306 |
| 36 | 3300000062 | IMNBL1DRAFT_c0013829 | IMNBL1DRAFT_00138293 | 307 |
| 37 | 3300042591 | Ga0466692_096905 | Ga0466692_096905_14789_15712 | 307 |
| 38 | 3300042599 | Ga0466706_021250 | Ga0466706_021250_331_1254 | 307 |
| 39 | 3300042601 | Ga0466707_415441 | Ga0466707_415441_646_1569 | 307 |
| 40 | 3300042606 | Ga0466719_568342 | Ga0466719_568342_809_1732 | 307 |
| 41 | 3300042615 | Ga0466711_178822 | Ga0466711_178822_973_1896 | 307 |
| 42 | 3300042615 | Ga0466711_180497 | Ga0466711_180497_972_1895 | 307 |
| 43 | 3300042621 | Ga0466729_083064 | Ga0466729_083064_156_1079 | 307 |
| 44 | 3300042624 | Ga0466735_097839 | Ga0466735_097839_2210_3133 | 307 |
| 45 | 3300042643 | Ga0466704_407394 | Ga0466704_407394_6099_7022 | 307 |
| 46 | 3300042652 | Ga0466708_381916 | Ga0466708_381916_31433_32356 | 307 |
| 47 | iso_pr_bacteria | 2940202316 | 2940203047 | 307 |
| 48 | 3300000062 | IMNBL1DRAFT_c0000738 | IMNBL1DRAFT_00007386 | 308 |
| 49 | 3300002504 | JGI24705J35276_12238629 | JGI24705J35276_1223862911 | 308 |
| 50 | 3300042599 | Ga0466706_021733 | Ga0466706_021733_11238_12164 | 308 |
| 51 | 3300042599 | Ga0466706_069566 | Ga0466706_069566_8594_9520 | 308 |
| 52 | 3300042606 | Ga0466719_299936 | Ga0466719_299936_2874_3800 | 308 |
| 53 | 3300042612 | Ga0466705_033023 | Ga0466705_033023_8588_9514 | 308 |
| 54 | 3300042612 | Ga0466705_053356 | Ga0466705_053356_3287_4213 | 308 |
| 55 | 3300042643 | Ga0466704_036166 | Ga0466704_036166_26_952 | 308 |
| 56 | 3300042648 | Ga0466709_376503 | Ga0466709_376503_979_1905 | 308 |
| 57 | 3300042652 | Ga0466708_120576 | Ga0466708_120576_16202_17128 | 308 |
| 58 | 3300042655 | Ga0466727_047526 | Ga0466727_047526_4106_5032 | 308 |
| 59 | iso_pr_bacteria | 2922326829 | 2922329482 | 308 |
| 60 | 2225789003 | 2226994264 | 2227345682 | 309 |
| 61 | 2225789004 | 2227480190 | 2227939342 | 309 |
| 62 | 3300002462 | JGI24702J35022_10083531 | JGI24702J35022_100835312 | 309 |
| 63 | 3300042590 | Ga0466690_091124 | Ga0466690_091124_8216_9145 | 309 |
| 64 | 3300042590 | Ga0466690_254356 | Ga0466690_254356_7612_8541 | 309 |
| 65 | 3300042591 | Ga0466692_100322 | Ga0466692_100322_90989_91918 | 309 |
| 66 | 3300042593 | Ga0466691_016966 | Ga0466691_016966_9679_10608 | 309 |
| 67 | 3300042593 | Ga0466691_081100 | Ga0466691_081100_3040_3969 | 309 |
| 68 | 3300042596 | Ga0466696_001911 | Ga0466696_001911_4441_5370 | 309 |
| 69 | 3300042596 | Ga0466696_148581 | Ga0466696_148581_316_1245 | 309 |
| 70 | 3300042598 | Ga0466701_013027 | Ga0466701_013027_19322_20251 | 309 |
| 71 | 3300042602 | Ga0466713_061789 | Ga0466713_061789_29650_30579 | 309 |
| 72 | 3300042605 | Ga0466716_028430 | Ga0466716_028430_7249_8178 | 309 |
| 73 | 3300042605 | Ga0466716_387237 | Ga0466716_387237_4139_5068 | 309 |
| 74 | 3300042605 | Ga0466716_410584 | Ga0466716_410584_49874_50803 | 309 |
| 75 | 3300042612 | Ga0466705_249448 | Ga0466705_249448_4556_5485 | 309 |
| 76 | 3300042615 | Ga0466711_007932 | Ga0466711_007932_14483_15412 | 309 |
| 77 | 3300042615 | Ga0466711_268980 | Ga0466711_268980_8889_9818 | 309 |
| 78 | 3300042615 | Ga0466711_286687 | Ga0466711_286687_9632_10561 | 309 |
| 79 | 3300042615 | Ga0466711_287615 | Ga0466711_287615_211_1140 | 309 |
| 80 | 3300042615 | Ga0466711_328156 | Ga0466711_328156_6206_7135 | 309 |
| 81 | 3300042616 | Ga0466715_072088 | Ga0466715_072088_25611_26540 | 309 |
| 82 | 3300042616 | Ga0466715_255108 | Ga0466715_255108_10459_11388 | 309 |
| 83 | 3300042619 | Ga0466726_049116 | Ga0466726_049116_3685_4614 | 309 |
| 84 | 3300042619 | Ga0466726_112168 | Ga0466726_112168_1774_2703 | 309 |
| 85 | 3300042619 | Ga0466726_382645 | Ga0466726_382645_2278_3207 | 309 |
| 86 | 3300042620 | Ga0466728_055345 | Ga0466728_055345_6409_7338 | 309 |
| 87 | 3300042624 | Ga0466735_084064 | Ga0466735_084064_119_1048 | 309 |
| 88 | 3300042636 | Ga0466703_021939 | Ga0466703_021939_4683_5612 | 309 |
| 89 | 3300042636 | Ga0466703_087510 | Ga0466703_087510_13597_14526 | 309 |
| 90 | 3300042643 | Ga0466704_065755 | Ga0466704_065755_1514_2443 | 309 |
| 91 | 3300042643 | Ga0466704_183723 | Ga0466704_183723_6576_7505 | 309 |
| 92 | 3300042643 | Ga0466704_303500 | Ga0466704_303500_6382_7311 | 309 |
| 93 | 3300042643 | Ga0466704_372245 | Ga0466704_372245_1650_2579 | 309 |
| 94 | 3300042643 | Ga0466704_479765 | Ga0466704_479765_13541_14470 | 309 |
| 95 | 3300042643 | Ga0466704_582225 | Ga0466704_582225_23732_24661 | 309 |
| 96 | 3300042648 | Ga0466709_039622 | Ga0466709_039622_15425_16354 | 309 |
| 97 | 3300042652 | Ga0466708_307050 | Ga0466708_307050_28623_29552 | 309 |
| 98 | 3300042655 | Ga0466727_163836 | Ga0466727_163836_80_1009 | 309 |
| 99 | 3300042655 | Ga0466727_246181 | Ga0466727_246181_254_1183 | 309 |
| 100 | 3300042659 | Ga0466733_170460 | Ga0466733_170460_69414_70343 | 309 |
| 101 | iso_pr_bacteria | 2820759988 | 2820760555 | 309 |
| 102 | iso_pr_bacteria | 2923982719 | 2923983284 | 309 |
| 103 | iso_pr_bacteria | 2940195863 | 2940197804 | 309 |
| 104 | iso_pr_bacteria | 2940371297 | 2940373420 | 309 |
| 105 | 2225789004 | 2227175247 | 2227590943 | 310 |
| 106 | 3300000062 | IMNBL1DRAFT_c0003452 | IMNBL1DRAFT_00034525 | 310 |
| 107 | 3300002509 | JGI24699J35502_11133360 | JGI24699J35502_111333604 | 310 |
| 108 | 3300005071 | Ga0068302_10141120 | Ga0068302_101411202 | 310 |
| 109 | 3300005071 | Ga0068302_10208052 | Ga0068302_102080522 | 310 |
| 110 | 3300005083 | Ga0068305_10026750 | Ga0068305_100267503 | 310 |
| 111 | 3300042601 | Ga0466707_189165 | Ga0466707_189165_359_1291 | 310 |
| 112 | 3300042602 | Ga0466713_085697 | Ga0466713_085697_31_963 | 310 |
| 113 | 3300042618 | Ga0466723_258914 | Ga0466723_258914_1602_2534 | 310 |
| 114 | 3300042655 | Ga0466727_041687 | Ga0466727_041687_2200_3132 | 310 |
| 115 | 3300042655 | Ga0466727_225961 | Ga0466727_225961_13564_14496 | 310 |
| 116 | 3300042659 | Ga0466733_030815 | Ga0466733_030815_5785_6717 | 310 |
| 117 | 3300000062 | IMNBL1DRAFT_c0003754 | IMNBL1DRAFT_00037544 | 311 |
| 118 | 3300005071 | Ga0068302_10191216 | Ga0068302_101912162 | 311 |
| 119 | 3300005083 | Ga0068305_10004417 | Ga0068305_1000441715 | 311 |
| 120 | 3300005083 | Ga0068305_10143422 | Ga0068305_101434227 | 311 |
| 121 | 3300009784 | Ga0123357_10106272 | Ga0123357_101062722 | 311 |
| 122 | 3300042605 | Ga0466716_317309 | Ga0466716_317309_2203_3138 | 311 |
| 123 | 3300042606 | Ga0466719_431354 | Ga0466719_431354_1739_2674 | 311 |
| 124 | 3300042609 | Ga0466722_015704 | Ga0466722_015704_27447_28382 | 311 |
| 125 | 3300042609 | Ga0466722_071447 | Ga0466722_071447_15261_16196 | 311 |
| 126 | 3300042615 | Ga0466711_443540 | Ga0466711_443540_12693_13628 | 311 |
| 127 | 3300042621 | Ga0466729_120951 | Ga0466729_120951_12642_13577 | 311 |
| 128 | 3300042636 | Ga0466703_121629 | Ga0466703_121629_3174_4109 | 311 |
| 129 | 3300042643 | Ga0466704_055943 | Ga0466704_055943_356_1291 | 311 |
| 130 | 3300042655 | Ga0466727_000978 | Ga0466727_000978_199_1134 | 311 |
| 131 | iso_pr_bacteria | 2940205530 | 2940206065 | 311 |
| 132 | iso_pr_bacteria | 2940212447 | 2940212980 | 311 |
| 133 | iso_pr_bacteria | 2940298504 | 2940299037 | 311 |
| 134 | iso_pr_bacteria | 2940302308 | 2940302891 | 311 |
| 135 | iso_pr_bacteria | 2940306115 | 2940306299 | 311 |
| 136 | iso_pr_bacteria | 2940309933 | 2940310068 | 311 |
| 137 | iso_pr_bacteria | 2940313741 | 2940313877 | 311 |
| 138 | iso_pr_bacteria | 2940317558 | 2940317742 | 311 |
| 139 | iso_pr_bacteria | 2940321370 | 2940321506 | 311 |
| 140 | iso_pr_bacteria | 2940325180 | 2940325763 | 311 |
| 141 | iso_pr_bacteria | 2940328985 | 2940329569 | 311 |
| 142 | iso_pr_bacteria | 2940332795 | 2940332979 | 311 |
| 143 | iso_pr_bacteria | 3004667792 | 3004671987 | 311 |
| 144 | 3300005071 | Ga0068302_10144470 | Ga0068302_101444703 | 312 |
| 145 | 3300042609 | Ga0466722_048206 | Ga0466722_048206_2431_3369 | 312 |
| 146 | iso_pr_bacteria | 2609459943 | 2610740566 | 313 |
| 147 | iso_pr_bacteria | 2820757377 | 2820758045 | 313 |
| 148 | iso_pr_bacteria | 2830041218 | 2830043115 | 313 |
| 149 | 3300002509 | JGI24699J35502_11133926 | JGI24699J35502_1113392615 | 314 |
| 150 | 3300042605 | Ga0466716_076910 | Ga0466716_076910_4531_5481 | 316 |
| 151 | 3300042590 | Ga0466690_198905 | Ga0466690_198905_141_1094 | 317 |
| 152 | 3300042655 | Ga0466727_095967 | Ga0466727_095967_1566_2522 | 318 |
| 153 | 3300005071 | Ga0068302_10044851 | Ga0068302_100448512 | 322 |
| 154 | 3300010882 | Ga0123354_10027610 | Ga0123354_100276108 | 326 |
| 155 | 3300042601 | Ga0466707_164963 | Ga0466707_164963_4414_5409 | 331 |
| 156 | 3300042616 | Ga0466715_368612 | Ga0466715_368612_2565_3566 | 333 |
| 157 | 3300042609 | Ga0466722_062477 | Ga0466722_062477_2088_3098 | 336 |
| 158 | 3300042636 | Ga0466703_289947 | Ga0466703_289947_8283_9302 | 339 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00294 | PfkB | pfkB family carbohydrate kinase | 50 | 314 | 0.85 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.