Protein Family IF09238

Metagenome Isolate
158 Members
62 Samples
133 Scaffolds
308.4 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_289947|Ga0466703_289947_8283_9302
Length
339 aa
Sequence
MPGVITAVIWDRKAVNRVKMKIHDFMRKVIGIGETVLDIIFQGDQPHAAVPGGSVFNGMVSLSRLGIPVTFVSELGNDRVGEMVCRFMRENGMTTDYMDVHPEGKTPVSLAFLSEQKNAEYLFYTGYPDRRSEMACPPVNEDDIFIFGSFYALDPRIRPWIVELLEYARQRKAIIYYDPNFRKIHTHKAIHVRSTVMDNYEYADLVRGSDEDFLNLYDRTDMDAVYRDEVHYYCKTLITTHGANGVRLFTDNLRLHFDVSAVTPVSTVGAGDNFNAGIIYGLLKQGVGRRDLPGLHAEAWKHIIRSGMELSAEVCLSYANYIPIDFAEKFSQRYSELKL

📊 Sample Types

Isolate 15.8%
Metagenome 84.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 33.9%
Kalotermitidae 22.6%
Termitidae 14.5%
Unclassified 9.7%
Termopsidae 6.5%
Rhinotermitidae 6.5%
Passalidae 4.8%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
4 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
15 2923982719 Parabacteroides sp. 52 Isolate Blattidae
16 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
17 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
18 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
32 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
33 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
38 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
39 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
40 3004667792 Bacteroides sp. 519 Isolate Blattidae
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
48 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
49 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
50 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
51 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
52 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 2922326829 Bacteroides sp. 224 Isolate Blattidae
58 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_030815 3300042659 Bacteria 19476
2 Ga0466711_180497 3300042615 Bacteria 4432
3 Ga0466690_091124 3300042590 Bacteria 36086
4 Ga0466701_013027 3300042598 Bacteria 25926
5 Ga0466707_283130 3300042601 Bacteria 2679
6 Ga0466735_084064 3300042624 Unclassified 1088
7 Ga0466704_065755 3300042643 Bacteria 13761
8 Ga0466704_407394 3300042643 Bacteria 14777
9 Ga0466709_376503 3300042648 Bacteria 12791
10 Ga0466727_095967 3300042655 Bacteria 3008
11 IMNBL1DRAFT_c0000738 3300000062 Bacteria 25952
12 JGI24705J35276_12238629 3300002504 Bacteria 30352
13 JGI24699J35502_11133926 3300002509 Bacteria 19671
14 Ga0068302_10044851 3300005071 Bacteria 4237
15 Ga0068305_10026750 3300005083 Bacteria 10368
16 Ga0466732_148619 3300042656 Bacteria 3716
17 Ga0123354_10027610 3300010882 Bacteria 8941
18 Ga0466711_443540 3300042615 Bacteria 17011
19 Ga0466726_079860 3300042619 Unclassified 5219
20 Ga0466729_083064 3300042621 Bacteria 1569
21 Ga0466692_097654 3300042591 Bacteria 22801
22 Ga0466691_016966 3300042593 Bacteria 13327
23 Ga0466713_044431 3300042602 Bacteria 51121
24 Ga0466735_043039 3300042624 Bacteria 1992
25 Ga0466703_087510 3300042636 Bacteria 17341
26 Ga0466704_372245 3300042643 Bacteria 13926
27 Ga0466704_499087 3300042643 Bacteria 6995
28 Ga0466704_582225 3300042643 Bacteria 53049
29 Ga0466708_120576 3300042652 Bacteria 34134
30 Ga0466708_307050 3300042652 Bacteria 51768
31 Ga0466727_000978 3300042655 Bacteria 1432
32 Ga0466727_047526 3300042655 Bacteria 13694
33 Ga0466727_163836 3300042655 Bacteria 2337
34 IMNBL1DRAFT_c0003452 3300000062 Bacteria 10153
35 Ga0068302_10141120 3300005071 Unclassified 2690
36 Ga0068302_10144470 3300005071 Bacteria 3342
37 Ga0466705_249448 3300042612 Bacteria 12035
38 Ga0466711_328156 3300042615 Bacteria 9449
39 Ga0466715_255108 3300042616 Bacteria 17635
40 Ga0466707_415441 3300042601 Bacteria 4570
41 Ga0466716_317309 3300042605 Bacteria 4899
42 Ga0466719_299936 3300042606 Bacteria 4408
43 Ga0466704_303500 3300042643 Bacteria 20207
44 Ga0466727_041687 3300042655 Bacteria 11156
45 JGI24702J35022_10083531 3300002462 Bacteria 1732
46 Ga0068302_10208052 3300005071 Bacteria 1370
47 Ga0466705_033023 3300042612 Bacteria 10482
48 Ga0123357_10014370 3300009784 Bacteria 10330
49 Ga0123354_10032871 3300010882 Bacteria 8125
50 Ga0466726_112168 3300042619 Bacteria 3347
51 Ga0466729_120951 3300042621 Bacteria 33674
52 Ga0466690_198905 3300042590 Bacteria 12802
53 Ga0466692_096905 3300042591 Bacteria 18961
54 Ga0466713_085697 3300042602 Bacteria 7961
55 Ga0466716_028430 3300042605 Bacteria 9140
56 Ga0466716_410584 3300042605 Bacteria 58331
57 Ga0466722_048206 3300042609 Bacteria 5022
58 Ga0466704_479765 3300042643 Bacteria 17636
59 Ga0466709_039622 3300042648 Bacteria 20117
60 2227175247 2225789004 Bacteria 8144
61 IMNBL1DRAFT_c0013829 3300000062 Bacteria 3595
62 Ga0068302_10191216 3300005071 Bacteria 3622
63 Ga0466705_053356 3300042612 Bacteria 6242
64 Ga0123357_10106272 3300009784 Bacteria 3599
65 Ga0466711_286687 3300042615 Bacteria 10769
66 Ga0466715_072088 3300042616 Bacteria 72248
67 Ga0466723_258914 3300042618 Bacteria 2794
68 Ga0466729_077417 3300042621 Bacteria 5055
69 Ga0466706_021250 3300042599 Bacteria 1866
70 Ga0466719_431354 3300042606 Bacteria 5137
71 Ga0466722_015704 3300042609 Bacteria 71312
72 Ga0466722_062477 3300042609 Bacteria 11403
73 Ga0466709_275287 3300042648 Archaea 2043
74 Ga0466708_381916 3300042652 Bacteria 41700
75 2227372472 2225789004 Bacteria 5996
76 IMNBL1DRAFT_c0003754 3300000062 Unclassified 9510
77 JGI24699J35502_11133360 3300002509 Bacteria 10095
78 Ga0466733_111660 3300042659 Bacteria 47113
79 Ga0123353_10195287 3300010167 Bacteria 3191
80 Ga0466726_174689 3300042619 Bacteria 1177
81 Ga0466692_100322 3300042591 Bacteria 97018
82 Ga0466696_148581 3300042596 Bacteria 2093
83 Ga0466706_163246 3300042599 Bacteria 60191
84 Ga0466707_189165 3300042601 Bacteria 2075
85 Ga0466713_061789 3300042602 Bacteria 88378
86 Ga0466719_568342 3300042606 Bacteria 2039
87 Ga0466735_097839 3300042624 Bacteria 7071
88 Ga0466703_021939 3300042636 Bacteria 9896
89 Ga0466703_121629 3300042636 Bacteria 5016
90 Ga0466704_406084 3300042643 Bacteria 4312
91 Ga0466704_493757 3300042643 Bacteria 5631
92 Ga0466727_151725 3300042655 Bacteria 4062
93 Ga0466733_170460 3300042659 Bacteria 186955
94 Ga0123357_10036635 3300009784 Bacteria 6675
95 Ga0123357_10044020 3300009784 Bacteria 6062
96 Ga0123354_10017849 3300010882 Bacteria 11118
97 Ga0466711_007932 3300042615 Bacteria 16347
98 Ga0466711_268980 3300042615 Bacteria 10316
99 Ga0466711_287615 3300042615 Bacteria 2914
100 Ga0466723_066496 3300042618 Bacteria 12360
101 Ga0466726_049116 3300042619 Bacteria 5096
102 Ga0466726_382645 3300042619 Bacteria 9872
103 Ga0466690_039569 3300042590 Bacteria 2581
104 Ga0466690_254356 3300042590 Bacteria 9443
105 Ga0466692_008872 3300042591 Bacteria 29437
106 Ga0466691_081100 3300042593 Bacteria 5406
107 Ga0466696_001911 3300042596 Bacteria 82336
108 Ga0466706_021733 3300042599 Bacteria 16070
109 Ga0466706_069566 3300042599 Bacteria 24649
110 Ga0466716_076910 3300042605 Bacteria 11677
111 Ga0466716_387237 3300042605 Bacteria 17852
112 Ga0466704_183723 3300042643 Bacteria 9904
113 Ga0466727_246181 3300042655 Bacteria 1771
114 2226994264 2225789003 Bacteria 6763
115 2227480190 2225789004 Bacteria 22361
116 Ga0068305_10004417 3300005083 Bacteria 55018
117 Ga0123357_10308900 3300009784 Bacteria 1583
118 Ga0123354_10072274 3300010882 Bacteria 4969
119 Ga0466711_178822 3300042615 Bacteria 4432
120 Ga0466711_400982 3300042615 Bacteria 5274
121 Ga0466715_368612 3300042616 Bacteria 6621
122 Ga0466728_055345 3300042620 Bacteria 34961
123 Ga0466706_007761 3300042599 Bacteria 10451
124 Ga0466707_164963 3300042601 Bacteria 15338
125 Ga0466707_415511 3300042601 Bacteria 3191
126 Ga0466722_071447 3300042609 Bacteria 21435
127 Ga0466703_289947 3300042636 Bacteria 14348
128 Ga0466704_031820 3300042643 Bacteria 15160
129 Ga0466704_036166 3300042643 Bacteria 1687
130 Ga0466704_055943 3300042643 Bacteria 3851
131 Ga0466727_225961 3300042655 Bacteria 24553
132 IMNBL1DRAFT_c0002089 3300000062 Bacteria 14219
133 Ga0068305_10143422 3300005083 Bacteria 6966

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_174689 Ga0466726_174689_32_862 255
2 3300010167 Ga0123353_10195287 Ga0123353_101952872 277
3 3300042591 Ga0466692_008872 Ga0466692_008872_3657_4568 285
4 3300042648 Ga0466709_275287 Ga0466709_275287_1162_2022 286
5 3300000062 IMNBL1DRAFT_c0002089 IMNBL1DRAFT_000208914 288
6 3300042602 Ga0466713_044431 Ga0466713_044431_29776_30645 289
7 3300042618 Ga0466723_066496 Ga0466723_066496_6663_7559 298
8 2225789004 2227372472 2227818893 299
9 3300042624 Ga0466735_043039 Ga0466735_043039_131_1039 302
10 3300042643 Ga0466704_499087 Ga0466704_499087_3706_4614 302
11 3300042590 Ga0466690_039569 Ga0466690_039569_1444_2355 303
12 3300042615 Ga0466711_400982 Ga0466711_400982_3526_4437 303
13 3300042621 Ga0466729_077417 Ga0466729_077417_627_1538 303
14 3300042643 Ga0466704_493757 Ga0466704_493757_2262_3173 303
15 3300042601 Ga0466707_283130 Ga0466707_283130_1437_2351 304
16 3300042643 Ga0466704_406084 Ga0466704_406084_467_1381 304
17 3300042656 Ga0466732_148619 Ga0466732_148619_1652_2566 304
18 3300042619 Ga0466726_079860 Ga0466726_079860_1584_2501 305
19 3300042643 Ga0466704_031820 Ga0466704_031820_1191_2108 305
20 3300042655 Ga0466727_151725 Ga0466727_151725_1168_2085 305
21 3300009784 Ga0123357_10014370 Ga0123357_100143707 306
22 3300009784 Ga0123357_10036635 Ga0123357_100366353 306
23 3300009784 Ga0123357_10044020 Ga0123357_100440205 306
24 3300009784 Ga0123357_10308900 Ga0123357_103089002 306
25 3300010882 Ga0123354_10017849 Ga0123354_100178494 306
26 3300010882 Ga0123354_10032871 Ga0123354_100328716 306
27 3300010882 Ga0123354_10072274 Ga0123354_100722746 306
28 3300042591 Ga0466692_097654 Ga0466692_097654_6315_7235 306
29 3300042599 Ga0466706_007761 Ga0466706_007761_2949_3869 306
30 3300042599 Ga0466706_163246 Ga0466706_163246_38437_39357 306
31 3300042601 Ga0466707_415511 Ga0466707_415511_290_1210 306
32 3300042659 Ga0466733_111660 Ga0466733_111660_37822_38742 306
33 iso_pr_bacteria 2940199050 2940201167 306
34 iso_pr_bacteria 2940209341 2940209549 306
35 iso_pr_bacteria 2940346213 2940349383 306
36 3300000062 IMNBL1DRAFT_c0013829 IMNBL1DRAFT_00138293 307
37 3300042591 Ga0466692_096905 Ga0466692_096905_14789_15712 307
38 3300042599 Ga0466706_021250 Ga0466706_021250_331_1254 307
39 3300042601 Ga0466707_415441 Ga0466707_415441_646_1569 307
40 3300042606 Ga0466719_568342 Ga0466719_568342_809_1732 307
41 3300042615 Ga0466711_178822 Ga0466711_178822_973_1896 307
42 3300042615 Ga0466711_180497 Ga0466711_180497_972_1895 307
43 3300042621 Ga0466729_083064 Ga0466729_083064_156_1079 307
44 3300042624 Ga0466735_097839 Ga0466735_097839_2210_3133 307
45 3300042643 Ga0466704_407394 Ga0466704_407394_6099_7022 307
46 3300042652 Ga0466708_381916 Ga0466708_381916_31433_32356 307
47 iso_pr_bacteria 2940202316 2940203047 307
48 3300000062 IMNBL1DRAFT_c0000738 IMNBL1DRAFT_00007386 308
49 3300002504 JGI24705J35276_12238629 JGI24705J35276_1223862911 308
50 3300042599 Ga0466706_021733 Ga0466706_021733_11238_12164 308
51 3300042599 Ga0466706_069566 Ga0466706_069566_8594_9520 308
52 3300042606 Ga0466719_299936 Ga0466719_299936_2874_3800 308
53 3300042612 Ga0466705_033023 Ga0466705_033023_8588_9514 308
54 3300042612 Ga0466705_053356 Ga0466705_053356_3287_4213 308
55 3300042643 Ga0466704_036166 Ga0466704_036166_26_952 308
56 3300042648 Ga0466709_376503 Ga0466709_376503_979_1905 308
57 3300042652 Ga0466708_120576 Ga0466708_120576_16202_17128 308
58 3300042655 Ga0466727_047526 Ga0466727_047526_4106_5032 308
59 iso_pr_bacteria 2922326829 2922329482 308
60 2225789003 2226994264 2227345682 309
61 2225789004 2227480190 2227939342 309
62 3300002462 JGI24702J35022_10083531 JGI24702J35022_100835312 309
63 3300042590 Ga0466690_091124 Ga0466690_091124_8216_9145 309
64 3300042590 Ga0466690_254356 Ga0466690_254356_7612_8541 309
65 3300042591 Ga0466692_100322 Ga0466692_100322_90989_91918 309
66 3300042593 Ga0466691_016966 Ga0466691_016966_9679_10608 309
67 3300042593 Ga0466691_081100 Ga0466691_081100_3040_3969 309
68 3300042596 Ga0466696_001911 Ga0466696_001911_4441_5370 309
69 3300042596 Ga0466696_148581 Ga0466696_148581_316_1245 309
70 3300042598 Ga0466701_013027 Ga0466701_013027_19322_20251 309
71 3300042602 Ga0466713_061789 Ga0466713_061789_29650_30579 309
72 3300042605 Ga0466716_028430 Ga0466716_028430_7249_8178 309
73 3300042605 Ga0466716_387237 Ga0466716_387237_4139_5068 309
74 3300042605 Ga0466716_410584 Ga0466716_410584_49874_50803 309
75 3300042612 Ga0466705_249448 Ga0466705_249448_4556_5485 309
76 3300042615 Ga0466711_007932 Ga0466711_007932_14483_15412 309
77 3300042615 Ga0466711_268980 Ga0466711_268980_8889_9818 309
78 3300042615 Ga0466711_286687 Ga0466711_286687_9632_10561 309
79 3300042615 Ga0466711_287615 Ga0466711_287615_211_1140 309
80 3300042615 Ga0466711_328156 Ga0466711_328156_6206_7135 309
81 3300042616 Ga0466715_072088 Ga0466715_072088_25611_26540 309
82 3300042616 Ga0466715_255108 Ga0466715_255108_10459_11388 309
83 3300042619 Ga0466726_049116 Ga0466726_049116_3685_4614 309
84 3300042619 Ga0466726_112168 Ga0466726_112168_1774_2703 309
85 3300042619 Ga0466726_382645 Ga0466726_382645_2278_3207 309
86 3300042620 Ga0466728_055345 Ga0466728_055345_6409_7338 309
87 3300042624 Ga0466735_084064 Ga0466735_084064_119_1048 309
88 3300042636 Ga0466703_021939 Ga0466703_021939_4683_5612 309
89 3300042636 Ga0466703_087510 Ga0466703_087510_13597_14526 309
90 3300042643 Ga0466704_065755 Ga0466704_065755_1514_2443 309
91 3300042643 Ga0466704_183723 Ga0466704_183723_6576_7505 309
92 3300042643 Ga0466704_303500 Ga0466704_303500_6382_7311 309
93 3300042643 Ga0466704_372245 Ga0466704_372245_1650_2579 309
94 3300042643 Ga0466704_479765 Ga0466704_479765_13541_14470 309
95 3300042643 Ga0466704_582225 Ga0466704_582225_23732_24661 309
96 3300042648 Ga0466709_039622 Ga0466709_039622_15425_16354 309
97 3300042652 Ga0466708_307050 Ga0466708_307050_28623_29552 309
98 3300042655 Ga0466727_163836 Ga0466727_163836_80_1009 309
99 3300042655 Ga0466727_246181 Ga0466727_246181_254_1183 309
100 3300042659 Ga0466733_170460 Ga0466733_170460_69414_70343 309
101 iso_pr_bacteria 2820759988 2820760555 309
102 iso_pr_bacteria 2923982719 2923983284 309
103 iso_pr_bacteria 2940195863 2940197804 309
104 iso_pr_bacteria 2940371297 2940373420 309
105 2225789004 2227175247 2227590943 310
106 3300000062 IMNBL1DRAFT_c0003452 IMNBL1DRAFT_00034525 310
107 3300002509 JGI24699J35502_11133360 JGI24699J35502_111333604 310
108 3300005071 Ga0068302_10141120 Ga0068302_101411202 310
109 3300005071 Ga0068302_10208052 Ga0068302_102080522 310
110 3300005083 Ga0068305_10026750 Ga0068305_100267503 310
111 3300042601 Ga0466707_189165 Ga0466707_189165_359_1291 310
112 3300042602 Ga0466713_085697 Ga0466713_085697_31_963 310
113 3300042618 Ga0466723_258914 Ga0466723_258914_1602_2534 310
114 3300042655 Ga0466727_041687 Ga0466727_041687_2200_3132 310
115 3300042655 Ga0466727_225961 Ga0466727_225961_13564_14496 310
116 3300042659 Ga0466733_030815 Ga0466733_030815_5785_6717 310
117 3300000062 IMNBL1DRAFT_c0003754 IMNBL1DRAFT_00037544 311
118 3300005071 Ga0068302_10191216 Ga0068302_101912162 311
119 3300005083 Ga0068305_10004417 Ga0068305_1000441715 311
120 3300005083 Ga0068305_10143422 Ga0068305_101434227 311
121 3300009784 Ga0123357_10106272 Ga0123357_101062722 311
122 3300042605 Ga0466716_317309 Ga0466716_317309_2203_3138 311
123 3300042606 Ga0466719_431354 Ga0466719_431354_1739_2674 311
124 3300042609 Ga0466722_015704 Ga0466722_015704_27447_28382 311
125 3300042609 Ga0466722_071447 Ga0466722_071447_15261_16196 311
126 3300042615 Ga0466711_443540 Ga0466711_443540_12693_13628 311
127 3300042621 Ga0466729_120951 Ga0466729_120951_12642_13577 311
128 3300042636 Ga0466703_121629 Ga0466703_121629_3174_4109 311
129 3300042643 Ga0466704_055943 Ga0466704_055943_356_1291 311
130 3300042655 Ga0466727_000978 Ga0466727_000978_199_1134 311
131 iso_pr_bacteria 2940205530 2940206065 311
132 iso_pr_bacteria 2940212447 2940212980 311
133 iso_pr_bacteria 2940298504 2940299037 311
134 iso_pr_bacteria 2940302308 2940302891 311
135 iso_pr_bacteria 2940306115 2940306299 311
136 iso_pr_bacteria 2940309933 2940310068 311
137 iso_pr_bacteria 2940313741 2940313877 311
138 iso_pr_bacteria 2940317558 2940317742 311
139 iso_pr_bacteria 2940321370 2940321506 311
140 iso_pr_bacteria 2940325180 2940325763 311
141 iso_pr_bacteria 2940328985 2940329569 311
142 iso_pr_bacteria 2940332795 2940332979 311
143 iso_pr_bacteria 3004667792 3004671987 311
144 3300005071 Ga0068302_10144470 Ga0068302_101444703 312
145 3300042609 Ga0466722_048206 Ga0466722_048206_2431_3369 312
146 iso_pr_bacteria 2609459943 2610740566 313
147 iso_pr_bacteria 2820757377 2820758045 313
148 iso_pr_bacteria 2830041218 2830043115 313
149 3300002509 JGI24699J35502_11133926 JGI24699J35502_1113392615 314
150 3300042605 Ga0466716_076910 Ga0466716_076910_4531_5481 316
151 3300042590 Ga0466690_198905 Ga0466690_198905_141_1094 317
152 3300042655 Ga0466727_095967 Ga0466727_095967_1566_2522 318
153 3300005071 Ga0068302_10044851 Ga0068302_100448512 322
154 3300010882 Ga0123354_10027610 Ga0123354_100276108 326
155 3300042601 Ga0466707_164963 Ga0466707_164963_4414_5409 331
156 3300042616 Ga0466715_368612 Ga0466715_368612_2565_3566 333
157 3300042609 Ga0466722_062477 Ga0466722_062477_2088_3098 336
158 3300042636 Ga0466703_289947 Ga0466703_289947_8283_9302 339

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 50 314 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.