Protein Family IF09236

Metagenome Isolate
154 Members
58 Samples
141 Scaffolds
446.81 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_286456|Ga0466703_286456_4536_6065
Length
509 aa
Sequence
MDSNRVKLTEKNQEAHQTRNFSGLLPVFTEKRRSVTPNFDTNFSVFHPNFVTKHYLCTKIRVMFERNIITELEKRLAKPNHKPLILRGSRQVGKTTLVDGFAQNFENYLYLNFEKKASAMVLFEKEQEIEDLVAEIFLFCGKKKQEGKTLLFIDEIQNSKTAITKLRYFYEAKIPDLHVIAAGSLLETMLNKKISFPVGRVEYLAVRPCTFNEFLRAIGEKVLETALPDRRIPEALHSKTMNLFNTFTLIGGMPEVVADYAENKDFVGLNNIYESLLTSYRDDVEKYAENNTMNQIIRYILKAGWKFAAQRITLGGFADSSYKAREMGEAFRTLEKTFVLELCYPTTDYLVPVTQDLKRSPKLLWLDCGLVNYAAKLQQEVFGAKDILDAYRGKIAEQIVAQELIALDSRVSNQRNFWVREKNTSQAEVDFILQFDGKVIPVEVKSGHNAKLKSLHLFMDKAPHNIAVRVWSQPFSIDEVTTQNGKKFKLFNLPFYYVGALEKMLMQYM

📊 Sample Types

Isolate 8.4%
Metagenome 91.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.7%
Unclassified 24.1%
Kalotermitidae 20.7%
Termopsidae 6.9%
Rhinotermitidae 5.2%
Hodotermitidae 1.7%
Passalidae 1.7%

🌳 Taxonomy

Archaea 8
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
16 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
21 2773857696 Unclassified Methanomassiliicoccaceae Th196P4bin4 Isolate Unclassified
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
24 2773857677 Methanoplasma sp. Cu122P5bin30 Isolate Unclassified
25 2773857686 Unclassified Methanomassiliicoccaceae Lab288P4bin70 Isolate Unclassified
26 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
40 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
47 2773857680 Unclassified Methanomassiliicoccaceae Emb289P3bin41 Isolate Unclassified
48 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
49 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
50 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
51 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466692_196455 3300042591 Bacteria 23185
2 Ga0466691_160239 3300042593 Bacteria 2001
3 Ga0123357_10176952 3300009784 Bacteria 2505
4 Ga0123356_10164577 3300010049 Bacteria 2220
5 Ga0123353_10552403 3300010167 Bacteria 1661
6 Ga0123354_10041736 3300010882 Unclassified 7085
7 Ga0466706_146547 3300042599 Bacteria 7806
8 Ga0466706_238084 3300042599 Bacteria 30415
9 Ga0466707_252850 3300042601 Bacteria 49003
10 Ga0466707_300039 3300042601 Bacteria 1906
11 Ga0466714_008179 3300042603 Bacteria 14991
12 Ga0466714_111374 3300042603 Bacteria 57741
13 Ga0466716_165798 3300042605 Bacteria 21702
14 Ga0466697_047215 3300042611 Bacteria 1740
15 Ga0466729_213234 3300042621 Bacteria 3941
16 Ga0466735_235494 3300042624 Bacteria 6847
17 Ga0466704_074859 3300042643 Unclassified 5298
18 JGI24702J35022_10006978 3300002462 Bacteria 6493
19 JGI24696J40584_12958603 3300002834 Bacteria 4256
20 Ga0466694_202192 3300042594 Bacteria 3422
21 Ga0123356_10015068 3300010049 Archaea 7415
22 Ga0123356_10202187 3300010049 Bacteria 2027
23 Ga0123353_10237568 3300010167 Bacteria 2835
24 Ga0123353_10248222 3300010167 Bacteria 2759
25 Ga0123353_10462909 3300010167 Bacteria 1862
26 Ga0466726_018403 3300042619 Unclassified 2847
27 Ga0466726_262975 3300042619 Bacteria 2110
28 Ga0466729_087581 3300042621 Bacteria 3302
29 Ga0466701_053384 3300042598 Bacteria 2137
30 Ga0466700_213390 3300042600 Bacteria 7516
31 Ga0466714_047729 3300042603 Bacteria 4296
32 Ga0466722_006825 3300042609 Bacteria 13653
33 Ga0466703_001513 3300042636 Bacteria 28601
34 Ga0466704_226434 3300042643 Unclassified 2385
35 Ga0466709_219154 3300042648 Bacteria 176728
36 Ga0466724_62632 3300042649 Bacteria 3950
37 JGI24702J35022_10023001 3300002462 Bacteria 3370
38 Ga0466705_056766 3300042612 Bacteria 8755
39 Ga0466705_354906 3300042612 Bacteria 74068
40 Ga0466733_007244 3300042659 Bacteria 4131
41 Ga0466733_188223 3300042659 Bacteria 2410
42 Ga0466690_012800 3300042590 Bacteria 15188
43 Ga0123356_10067656 3300010049 Archaea 3345
44 Ga0123353_10009199 3300010167 Bacteria 13597
45 Ga0123353_10073987 3300010167 Bacteria 5477
46 Ga0123354_10000180 3300010882 Bacteria 53026
47 Ga0123354_10000287 3300010882 Bacteria 45857
48 Ga0123354_10118305 3300010882 Bacteria 3441
49 Ga0123354_10168309 3300010882 Bacteria 2564
50 Ga0123354_10267961 3300010882 Bacteria 1688
51 Ga0466705_473769 3300042612 Bacteria 1493
52 Ga0466711_015873 3300042615 Bacteria 6161
53 Ga0466711_024281 3300042615 Bacteria 7821
54 Ga0466715_216973 3300042616 Bacteria 5322
55 Ga0466726_085136 3300042619 Bacteria 3777
56 Ga0466706_000548 3300042599 Bacteria 24178
57 Ga0466719_270527 3300042606 Bacteria 1982
58 Ga0466734_075644 3300042623 Bacteria 1942
59 Ga0466727_137368 3300042655 Bacteria 15897
60 JGI24702J35022_10046530 3300002462 Bacteria 2310
61 Ga0466697_222911 3300042611 Bacteria 4339
62 Ga0466733_077258 3300042659 Bacteria 1508
63 Ga0466692_052397 3300042591 Bacteria 2153
64 Ga0466693_398063 3300042592 Bacteria 2000
65 Ga0123353_10000023 3300010167 Bacteria 173512
66 Ga0123354_10000339 3300010882 Bacteria 43682
67 Ga0123354_10176135 3300010882 Bacteria 2464
68 Ga0466726_030300 3300042619 Bacteria 2270
69 Ga0466726_274498 3300042619 Bacteria 1833
70 Ga0466728_236898 3300042620 Bacteria 11626
71 Ga0466717_184554 3300042604 Bacteria 3187
72 Ga0466703_026331 3300042636 Bacteria 1681
73 Ga0466703_074543 3300042636 Unclassified 2968
74 JGI24702J35022_10002675 3300002462 Bacteria 10817
75 Ga0466733_058757 3300042659 Bacteria 3328
76 Ga0415639_046618 3300038395 Archaea 2631
77 Ga0466694_250012 3300042594 Bacteria 1609
78 Ga0466696_059095 3300042596 Bacteria 32844
79 Ga0123356_10055032 3300010049 Unclassified 3705
80 Ga0123354_10065227 3300010882 Bacteria 5330
81 Ga0466715_563029 3300042616 Bacteria 6272
82 Ga0466706_051450 3300042599 Bacteria 6110
83 Ga0466706_104744 3300042599 Bacteria 41897
84 Ga0466721_024365 3300042608 Bacteria 1456
85 Ga0466731_176593 3300042622 Bacteria 1843
86 Ga0466731_203723 3300042622 Bacteria 1800
87 Ga0466703_049468 3300042636 Bacteria 5854
88 Ga0466727_160500 3300042655 Bacteria 3337
89 Ga0123357_10001679 3300009784 Bacteria 23815
90 Ga0466690_242016 3300042590 Bacteria 6738
91 Ga0466692_011845 3300042591 Bacteria 29079
92 Ga0466692_172170 3300042591 Bacteria 1373
93 Ga0466691_012128 3300042593 Bacteria 43191
94 Ga0466694_030584 3300042594 Bacteria 71743
95 Ga0123356_10003257 3300010049 Bacteria 17043
96 Ga0123353_10068623 3300010167 Bacteria 5694
97 Ga0123353_10259864 3300010167 Unclassified 2683
98 Ga0123354_10058419 3300010882 Bacteria 5732
99 Ga0123354_10100779 3300010882 Unclassified 3906
100 Ga0466710_145290 3300042613 Bacteria 3051
101 Ga0466711_076063 3300042615 Unclassified 2709
102 Ga0466711_099584 3300042615 Bacteria 34400
103 Ga0466701_088079 3300042598 Bacteria 3063
104 Ga0466721_160779 3300042608 Bacteria 21993
105 Ga0466731_322069 3300042622 Bacteria 2370
106 Ga0466704_345055 3300042643 Bacteria 5249
107 2227103027 2225789004 Unclassified 9563
108 Ga0466656_214006 3300042550 Archaea 3823
109 Ga0466693_278638 3300042592 Bacteria 1348
110 Ga0466696_324414 3300042596 Bacteria 1648
111 Ga0123357_10114942 3300009784 Bacteria 3414
112 Ga0123356_10115358 3300010049 Bacteria 2602
113 Ga0123353_10453547 3300010167 Bacteria 1887
114 Ga0466712_103514 3300042614 Bacteria 2618
115 Ga0466711_202324 3300042615 Bacteria 2172
116 Ga0466726_151668 3300042619 Bacteria 1717
117 Ga0466729_192565 3300042621 Unclassified 2736
118 Ga0466706_095154 3300042599 Unclassified 2535
119 Ga0466707_105145 3300042601 Bacteria 2512
120 Ga0466714_108011 3300042603 Bacteria 4057
121 Ga0466717_201461 3300042604 Bacteria 2565
122 Ga0466722_123031 3300042609 Bacteria 32122
123 Ga0466697_017284 3300042611 Bacteria 2908
124 Ga0466703_319661 3300042636 Bacteria 11976
125 Ga0466727_180937 3300042655 Bacteria 2478
126 2227648257 2225789004 Bacteria 2016
127 JGI24702J35022_10021085 3300002462 Bacteria 3536
128 JGI24702J35022_10032166 3300002462 Bacteria 2809
129 JGI24696J40584_12941527 3300002834 Bacteria 1711
130 JGI24696J40584_12960565 3300002834 Bacteria 7600
131 Ga0123357_10031848 3300009784 Bacteria 7154
132 Ga0123353_10197700 3300010167 Bacteria 3167
133 Ga0466710_220212 3300042613 Bacteria 1296
134 Ga0466711_206797 3300042615 Bacteria 7081
135 Ga0466706_178083 3300042599 Bacteria 37293
136 Ga0466703_286456 3300042636 Bacteria 7184
137 2227609345 2225789004 Bacteria 2273
138 JGI24702J35022_10000094 3300002462 Bacteria 40308
139 JGI24702J35022_10006616 3300002462 Bacteria 6692
140 JGI24699J35502_11134175 3300002509 Bacteria 44626
141 Ga0068302_10084587 3300005071 Bacteria 5445

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_220212 Ga0466710_220212_110_1285 391
2 3300042592 Ga0466693_278638 Ga0466693_278638_104_1333 409
3 3300042591 Ga0466692_172170 Ga0466692_172170_123_1361 412
4 3300042621 Ga0466729_087581 Ga0466729_087581_2022_3260 412
5 3300042592 Ga0466693_398063 Ga0466693_398063_739_1983 414
6 3300042599 Ga0466706_178083 Ga0466706_178083_28321_29568 415
7 3300042615 Ga0466711_076063 Ga0466711_076063_364_1701 428
8 3300002462 JGI24702J35022_10006978 JGI24702J35022_100069789 430
9 3300042608 Ga0466721_160779 Ga0466721_160779_360_1709 430
10 3300010049 Ga0123356_10003257 Ga0123356_1000325711 431
11 3300042659 Ga0466733_188223 Ga0466733_188223_141_1487 431
12 3300042636 Ga0466703_049468 Ga0466703_049468_3493_4839 432
13 3300042612 Ga0466705_473769 Ga0466705_473769_168_1475 435
14 2225789004 2227103027 2227487375 436
15 3300010882 Ga0123354_10000339 Ga0123354_100003397 436
16 3300042615 Ga0466711_206797 Ga0466711_206797_426_1772 436
17 3300042615 Ga0466711_015873 Ga0466711_015873_2903_4219 438
18 3300042636 Ga0466703_074543 Ga0466703_074543_888_2231 439
19 3300042609 Ga0466722_006825 Ga0466722_006825_8183_9505 440
20 3300042615 Ga0466711_099584 Ga0466711_099584_26313_27635 440
21 3300042591 Ga0466692_011845 Ga0466692_011845_26164_27510 441
22 3300042619 Ga0466726_018403 Ga0466726_018403_11_1336 441
23 3300042619 Ga0466726_030300 Ga0466726_030300_480_1805 441
24 2225789004 2227609345 2228180209 442
25 2225789004 2227648257 2228242471 442
26 3300002462 JGI24702J35022_10000094 JGI24702J35022_1000009418 442
27 3300002834 JGI24696J40584_12941527 JGI24696J40584_129415271 442
28 3300042615 Ga0466711_202324 Ga0466711_202324_242_1570 442
29 3300005071 Ga0068302_10084587 Ga0068302_100845871 443
30 3300010167 Ga0123353_10237568 Ga0123353_102375682 443
31 3300010167 Ga0123353_10259864 Ga0123353_102598642 443
32 3300010882 Ga0123354_10000180 Ga0123354_100001809 443
33 3300010882 Ga0123354_10100779 Ga0123354_101007792 443
34 3300010882 Ga0123354_10118305 Ga0123354_101183051 443
35 3300042599 Ga0466706_051450 Ga0466706_051450_4128_5459 443
36 3300042599 Ga0466706_095154 Ga0466706_095154_751_2082 443
37 3300009784 Ga0123357_10001679 Ga0123357_1000167913 444
38 3300042609 Ga0466722_123031 Ga0466722_123031_19157_20491 444
39 3300042621 Ga0466729_192565 Ga0466729_192565_962_2296 444
40 3300042655 Ga0466727_137368 Ga0466727_137368_14317_15651 444
41 3300042655 Ga0466727_180937 Ga0466727_180937_177_1511 444
42 3300002462 JGI24702J35022_10046530 JGI24702J35022_100465302 445
43 3300009784 Ga0123357_10176952 Ga0123357_101769522 445
44 3300010049 Ga0123356_10202187 Ga0123356_102021872 445
45 3300042594 Ga0466694_250012 Ga0466694_250012_210_1547 445
46 3300042611 Ga0466697_017284 Ga0466697_017284_1019_2356 445
47 3300042613 Ga0466710_145290 Ga0466710_145290_1494_2831 445
48 3300042615 Ga0466711_024281 Ga0466711_024281_5694_7031 445
49 3300042619 Ga0466726_262975 Ga0466726_262975_398_1735 445
50 3300042619 Ga0466726_274498 Ga0466726_274498_182_1519 445
51 3300042621 Ga0466729_213234 Ga0466729_213234_1117_2454 445
52 3300042648 Ga0466709_219154 Ga0466709_219154_52218_53555 445
53 3300010167 Ga0123353_10462909 Ga0123353_104629092 446
54 3300042550 Ga0466656_214006 Ga0466656_214006_1321_2661 446
55 3300042591 Ga0466692_052397 Ga0466692_052397_448_1788 446
56 3300042594 Ga0466694_202192 Ga0466694_202192_85_1425 446
57 3300042598 Ga0466701_053384 Ga0466701_053384_586_1926 446
58 3300042599 Ga0466706_000548 Ga0466706_000548_17425_18765 446
59 3300042599 Ga0466706_238084 Ga0466706_238084_27364_28704 446
60 3300042601 Ga0466707_105145 Ga0466707_105145_786_2126 446
61 3300042601 Ga0466707_300039 Ga0466707_300039_125_1465 446
62 3300042603 Ga0466714_108011 Ga0466714_108011_734_2074 446
63 3300042604 Ga0466717_184554 Ga0466717_184554_1518_2858 446
64 3300042608 Ga0466721_024365 Ga0466721_024365_84_1424 446
65 3300042611 Ga0466697_047215 Ga0466697_047215_243_1583 446
66 3300042624 Ga0466735_235494 Ga0466735_235494_3149_4489 446
67 iso_pr_bacteria 2820741847 2820742192 446
68 iso_pr_bacteria 2820753519 2820754627 446
69 iso_pr_bacteria 2820755292 2820756054 446
70 iso_pr_bacteria 2820789850 2820790188 446
71 iso_pr_bacteria 2967483437 2967487326 446
72 3300002462 JGI24702J35022_10032166 JGI24702J35022_100321662 447
73 3300010049 Ga0123356_10115358 Ga0123356_101153582 447
74 3300010882 Ga0123354_10000287 Ga0123354_1000028732 447
75 3300042590 Ga0466690_012800 Ga0466690_012800_6178_7521 447
76 3300042590 Ga0466690_242016 Ga0466690_242016_1458_2801 447
77 3300042614 Ga0466712_103514 Ga0466712_103514_477_1820 447
78 3300042616 Ga0466715_563029 Ga0466715_563029_4425_5768 447
79 3300042622 Ga0466731_322069 Ga0466731_322069_504_1847 447
80 3300042643 Ga0466704_226434 Ga0466704_226434_653_1996 447
81 3300042643 Ga0466704_345055 Ga0466704_345055_3118_4461 447
82 3300002462 JGI24702J35022_10002675 JGI24702J35022_1000267510 448
83 3300002462 JGI24702J35022_10006616 JGI24702J35022_100066167 448
84 3300002462 JGI24702J35022_10021085 JGI24702J35022_100210853 448
85 3300002834 JGI24696J40584_12958603 JGI24696J40584_129586033 448
86 3300002834 JGI24696J40584_12960565 JGI24696J40584_129605654 448
87 3300009784 Ga0123357_10031848 Ga0123357_100318484 448
88 3300010167 Ga0123353_10068623 Ga0123353_100686233 448
89 3300010167 Ga0123353_10248222 Ga0123353_102482223 448
90 3300010882 Ga0123354_10065227 Ga0123354_100652277 448
91 3300010882 Ga0123354_10176135 Ga0123354_101761352 448
92 3300042591 Ga0466692_196455 Ga0466692_196455_16534_17880 448
93 3300042593 Ga0466691_012128 Ga0466691_012128_38177_39523 448
94 3300042599 Ga0466706_104744 Ga0466706_104744_5310_6656 448
95 3300042599 Ga0466706_146547 Ga0466706_146547_5509_6855 448
96 3300042600 Ga0466700_213390 Ga0466700_213390_260_1606 448
97 3300042603 Ga0466714_008179 Ga0466714_008179_485_1831 448
98 3300042603 Ga0466714_111374 Ga0466714_111374_30177_31523 448
99 3300042605 Ga0466716_165798 Ga0466716_165798_15152_16498 448
100 3300042611 Ga0466697_222911 Ga0466697_222911_1883_3229 448
101 3300042612 Ga0466705_354906 Ga0466705_354906_20092_21438 448
102 3300042619 Ga0466726_151668 Ga0466726_151668_223_1569 448
103 3300042620 Ga0466728_236898 Ga0466728_236898_5833_7179 448
104 3300042622 Ga0466731_203723 Ga0466731_203723_262_1608 448
105 3300042636 Ga0466703_001513 Ga0466703_001513_22844_24190 448
106 3300042636 Ga0466703_319661 Ga0466703_319661_3828_5174 448
107 3300042643 Ga0466704_074859 Ga0466704_074859_3005_4351 448
108 3300042659 Ga0466733_007244 Ga0466733_007244_2054_3400 448
109 3300042659 Ga0466733_058757 Ga0466733_058757_1386_2732 448
110 3300010049 Ga0123356_10015068 Ga0123356_100150688 449
111 3300010167 Ga0123353_10197700 Ga0123353_101977003 449
112 3300042593 Ga0466691_160239 Ga0466691_160239_104_1453 449
113 3300042603 Ga0466714_047729 Ga0466714_047729_1680_3029 449
114 3300042616 Ga0466715_216973 Ga0466715_216973_3531_4880 449
115 3300042659 Ga0466733_077258 Ga0466733_077258_124_1473 449
116 iso_pr_bacteria 2820757377 2820759130 449
117 iso_pu_archaea 2773857686 2774159615 449
118 3300010167 Ga0123353_10453547 Ga0123353_104535472 450
119 3300010882 Ga0123354_10041736 Ga0123354_100417364 450
120 3300010882 Ga0123354_10168309 Ga0123354_101683093 450
121 3300042596 Ga0466696_059095 Ga0466696_059095_29184_30536 450
122 3300042604 Ga0466717_201461 Ga0466717_201461_73_1425 450
123 3300042619 Ga0466726_085136 Ga0466726_085136_1326_2678 450
124 3300042622 Ga0466731_176593 Ga0466731_176593_379_1731 450
125 iso_pu_archaea 2773857680 2774151514 450
126 3300010167 Ga0123353_10552403 Ga0123353_105524031 451
127 3300042598 Ga0466701_088079 Ga0466701_088079_488_1843 451
128 3300010049 Ga0123356_10055032 Ga0123356_100550323 452
129 3300010049 Ga0123356_10067656 Ga0123356_100676563 452
130 iso_pr_bacteria 2820767225 2820768025 452
131 iso_pr_bacteria 2820772500 2820773829 452
132 3300010167 Ga0123353_10073987 Ga0123353_100739876 453
133 3300042623 Ga0466734_075644 Ga0466734_075644_502_1896 453
134 3300002509 JGI24699J35502_11134175 JGI24699J35502_111341757 454
135 3300010049 Ga0123356_10164577 Ga0123356_101645772 454
136 3300010167 Ga0123353_10009199 Ga0123353_100091995 454
137 iso_pu_archaea 2773857696 2774174042 454
138 3300002462 JGI24702J35022_10023001 JGI24702J35022_100230013 455
139 3300042596 Ga0466696_324414 Ga0466696_324414_219_1586 455
140 3300010882 Ga0123354_10267961 Ga0123354_102679612 456
141 3300010167 Ga0123353_10000023 Ga0123353_1000002332 457
142 3300042655 Ga0466727_160500 Ga0466727_160500_342_1715 457
143 3300042601 Ga0466707_252850 Ga0466707_252850_30727_32106 459
144 3300042649 Ga0466724_62632 Ga0466724_62632_1633_3081 461
145 3300010882 Ga0123354_10058419 Ga0123354_100584194 466
146 3300009784 Ga0123357_10114942 Ga0123357_101149422 469
147 3300042594 Ga0466694_030584 Ga0466694_030584_62529_63941 470
148 3300038395 Ga0415639_046618 Ga0415639_046618_998_2473 471
149 3300042636 Ga0466703_026331 Ga0466703_026331_56_1471 471
150 3300042612 Ga0466705_056766 Ga0466705_056766_7123_8541 472
151 3300042606 Ga0466719_270527 Ga0466719_270527_235_1665 476
152 iso_pr_bacteria 2820797595 2820799412 483
153 iso_pu_archaea 2773857677 2774147969 483
154 3300042636 Ga0466703_286456 Ga0466703_286456_4536_6065 509

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13173 AAA_14 AAA domain 81 215 0.84
PF13635 DUF4143 Domain of unknown function (DUF4143) 306 447 0.72

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.