Protein Family IF09214
Metagenome
Isolate
158
Members
81
Samples
132
Scaffolds
216.45
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_240214|Ga0466703_240214_995_1714
- Length
- 239 aa
- Sequence
- LFKQKCITFVGSKVKEQIFLAPKIMEYIHLFIDFFLHLDIHLVELLQNYGFWIYGILFVIIFCETGLVVTPFLPGDSLLFVAGTLASVGTNHINVHLMVLLLVTAAVLGDACNYMIGKFFGEKLFRNPDSKIFKQSYLEKTHNFYEKHGGKTIILARFVPIVRTFAPFVAGRGKMGYTRFFSYNVMGGTVWVAVFMYIGYFFGELEFVKKNLTILAIVIIFISVLPALFEVWRNKRIRN
Sample Types
Isolate
16.5%
Metagenome
83.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
17.5%
Formicidae
16.2%
Unclassified
12.5%
Termitidae
12.5%
Apidae
6.2%
Elmidae
6.2%
Termopsidae
5.0%
Rhinotermitidae
5.0%
Curculionidae
2.5%
Hydrophilidae
2.5%
Aphididae
2.5%
Passalidae
2.5%
Blattidae
2.5%
Pteromalidae
1.2%
Aleyrodidae
1.2%
Tenebrionidae
1.2%
Hodotermitidae
1.2%
Drosophilidae
1.2%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 2 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 3 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 6 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 19 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 20 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 21 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 22 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 23 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 26 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 27 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 28 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 29 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 30 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 31 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 32 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 33 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 34 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 37 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 44 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 45 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 46 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 47 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 48 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 58 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 59 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 60 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 61 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 62 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 65 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 66 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 67 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 68 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 69 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 70 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 71 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 72 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 73 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 76 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 77 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_199437 | 3300042612 | Bacteria | 1354 |
| 2 | Ga0466733_034755 | 3300042659 | Bacteria | 4402 |
| 3 | Ga0466690_433579 | 3300042590 | Bacteria | 2314 |
| 4 | JGI24702J35022_10079866 | 3300002462 | Bacteria | 1771 |
| 5 | Ga0068305_10019290 | 3300005083 | Bacteria | 9085 |
| 6 | Ga0102736_1001776 | 3300007052 | Unclassified | 3635 |
| 7 | Ga0103261_1004997 | 3300007083 | Unclassified | 1972 |
| 8 | Ga0103268_1000936 | 3300007192 | Unclassified | 7912 |
| 9 | Ga0466701_075119 | 3300042598 | Bacteria | 16219 |
| 10 | Ga0466714_105572 | 3300042603 | Bacteria | 2477 |
| 11 | Ga0466716_237078 | 3300042605 | Bacteria | 20430 |
| 12 | Ga0466716_506150 | 3300042605 | Bacteria | 11490 |
| 13 | Ga0466698_419105 | 3300042610 | Bacteria | 2540 |
| 14 | Ga0466715_086110 | 3300042616 | Unclassified | 4142 |
| 15 | Ga0466735_171398 | 3300042624 | Bacteria | 1447 |
| 16 | Ga0466735_228417 | 3300042624 | Bacteria | 15817 |
| 17 | Ga0466703_132322 | 3300042636 | Bacteria | 1907 |
| 18 | Ga0466703_255239 | 3300042636 | Bacteria | 16694 |
| 19 | Ga0466709_081949 | 3300042648 | Bacteria | 1358 |
| 20 | Ga0466690_064779 | 3300042590 | Bacteria | 1732 |
| 21 | Ga0466692_072596 | 3300042591 | Bacteria | 23386 |
| 22 | Ga0466693_331635 | 3300042592 | Bacteria | 3578 |
| 23 | Ga0466701_005914 | 3300042598 | Bacteria | 55661 |
| 24 | 2227474936 | 2225789004 | Bacteria | 4691 |
| 25 | IMNBL1DRAFT_c0003566 | 3300000062 | Bacteria | 9887 |
| 26 | JGI24702J35022_10011816 | 3300002462 | Bacteria | 4865 |
| 27 | Ga0103266_1000115 | 3300007067 | Bacteria | 29900 |
| 28 | Ga0466706_099418 | 3300042599 | Bacteria | 16376 |
| 29 | Ga0466705_474695 | 3300042612 | Bacteria | 10861 |
| 30 | Ga0466715_005011 | 3300042616 | Bacteria | 1884 |
| 31 | Ga0466715_056569 | 3300042616 | Bacteria | 35867 |
| 32 | Ga0466728_200812 | 3300042620 | Bacteria | 2972 |
| 33 | Ga0466728_390106 | 3300042620 | Bacteria | 1482 |
| 34 | Ga0466729_226092 | 3300042621 | Bacteria | 10009 |
| 35 | Ga0466729_230531 | 3300042621 | Bacteria | 10485 |
| 36 | Ga0466709_267822 | 3300042648 | Bacteria | 8540 |
| 37 | Ga0466708_301949 | 3300042652 | Bacteria | 21510 |
| 38 | Ga0466733_080263 | 3300042659 | Bacteria | 1828 |
| 39 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 40 | Ga0136159_1000020 | 3300010217 | Bacteria | 104555 |
| 41 | 2227145542 | 2225789004 | Bacteria | 1606 |
| 42 | 2227566589 | 2225789004 | Bacteria | 2664 |
| 43 | Ga0068302_10202601 | 3300005071 | Unclassified | 1814 |
| 44 | Ga0103265_1002844 | 3300007068 | Bacteria | 2633 |
| 45 | Ga0103264_1000692 | 3300007188 | Bacteria | 26429 |
| 46 | Ga0466707_034329 | 3300042601 | Bacteria | 14545 |
| 47 | Ga0466711_015732 | 3300042615 | Bacteria | 22229 |
| 48 | Ga0466711_387227 | 3300042615 | Bacteria | 12822 |
| 49 | Ga0466711_466224 | 3300042615 | Bacteria | 1524 |
| 50 | Ga0466723_044466 | 3300042618 | Bacteria | 10487 |
| 51 | Ga0466735_181811 | 3300042624 | Bacteria | 36900 |
| 52 | Ga0466703_084836 | 3300042636 | Bacteria | 30933 |
| 53 | Ga0466704_109326 | 3300042643 | Bacteria | 9302 |
| 54 | Ga0466705_023779 | 3300042612 | Bacteria | 12423 |
| 55 | Ga0466690_052150 | 3300042590 | Bacteria | 19616 |
| 56 | Ga0466692_157530 | 3300042591 | Bacteria | 2053 |
| 57 | DPOL_contig00972 | 2035918003 | Bacteria | 11881 |
| 58 | JGI24705J35276_12234812 | 3300002504 | Bacteria | 5876 |
| 59 | WW0001_100248 | 3300002732 | Bacteria | 167261 |
| 60 | Ga0466707_058054 | 3300042601 | Bacteria | 2090 |
| 61 | Ga0466716_524202 | 3300042605 | Bacteria | 4529 |
| 62 | Ga0466719_493792 | 3300042606 | Bacteria | 1246 |
| 63 | Ga0466711_030594 | 3300042615 | Bacteria | 22572 |
| 64 | Ga0466715_050811 | 3300042616 | Bacteria | 4447 |
| 65 | Ga0466715_206916 | 3300042616 | Bacteria | 10776 |
| 66 | Ga0466723_271725 | 3300042618 | Bacteria | 5168 |
| 67 | Ga0466728_076186 | 3300042620 | Bacteria | 3491 |
| 68 | Ga0466704_179826 | 3300042643 | Bacteria | 45154 |
| 69 | Ga0466724_50202 | 3300042649 | Bacteria | 22667 |
| 70 | Ga0466727_079697 | 3300042655 | Bacteria | 1897 |
| 71 | Ga0466727_168732 | 3300042655 | Bacteria | 4335 |
| 72 | Ga0466705_119052 | 3300042612 | Bacteria | 5655 |
| 73 | Ga0466690_055481 | 3300042590 | Bacteria | 72316 |
| 74 | Ga0466693_355438 | 3300042592 | Bacteria | 1273 |
| 75 | Ga0466691_167953 | 3300042593 | Bacteria | 2672 |
| 76 | Ga0466696_506237 | 3300042596 | Bacteria | 4233 |
| 77 | HBC_ctgsDRAFT_1000443 | 3300000333 | Bacteria | 9366 |
| 78 | HBC_ctgsDRAFT_1009566 | 3300000333 | Unclassified | 2306 |
| 79 | JGI24702J35022_10139329 | 3300002462 | Bacteria | 1352 |
| 80 | JGI24699J35502_11134134 | 3300002509 | Bacteria | 35214 |
| 81 | Ga0068302_10020862 | 3300005071 | Unclassified | 6518 |
| 82 | Ga0102735_1001039 | 3300007080 | Unclassified | 5887 |
| 83 | Ga0102734_1006182 | 3300007129 | Bacteria | 2680 |
| 84 | Ga0104044_1151160 | 3300007136 | Bacteria | 983 |
| 85 | Ga0102737_1004722 | 3300007142 | Unclassified | 2845 |
| 86 | Ga0466707_231574 | 3300042601 | Bacteria | 63346 |
| 87 | Ga0466719_026740 | 3300042606 | Bacteria | 10500 |
| 88 | Ga0466719_497203 | 3300042606 | Bacteria | 34034 |
| 89 | Ga0466723_030264 | 3300042618 | Bacteria | 6780 |
| 90 | Ga0466726_155249 | 3300042619 | Bacteria | 6190 |
| 91 | Ga0466726_274018 | 3300042619 | Bacteria | 3781 |
| 92 | Ga0466729_132295 | 3300042621 | Bacteria | 3259 |
| 93 | Ga0466703_043477 | 3300042636 | Bacteria | 3969 |
| 94 | Ga0466703_240214 | 3300042636 | Bacteria | 2110 |
| 95 | Ga0466727_264886 | 3300042655 | Bacteria | 6092 |
| 96 | IMNBL1DRAFT_c0001060 | 3300000062 | Bacteria | 21260 |
| 97 | JGI24702J35022_10022311 | 3300002462 | Bacteria | 3428 |
| 98 | Ga0103260_1005040 | 3300007139 | Unclassified | 1970 |
| 99 | Ga0466707_406513 | 3300042601 | Bacteria | 6356 |
| 100 | Ga0466716_476877 | 3300042605 | Bacteria | 11922 |
| 101 | Ga0466719_021038 | 3300042606 | Bacteria | 13129 |
| 102 | Ga0466722_062829 | 3300042609 | Bacteria | 60409 |
| 103 | Ga0466715_057350 | 3300042616 | Bacteria | 4804 |
| 104 | Ga0466715_120539 | 3300042616 | Bacteria | 16996 |
| 105 | Ga0466715_565336 | 3300042616 | Bacteria | 22617 |
| 106 | Ga0466729_287403 | 3300042621 | Bacteria | 1484 |
| 107 | Ga0466735_090569 | 3300042624 | Bacteria | 2491 |
| 108 | Ga0466703_193733 | 3300042636 | Bacteria | 3232 |
| 109 | Ga0466705_241116 | 3300042612 | Bacteria | 7318 |
| 110 | 2227599071 | 2225789004 | Unclassified | 2352 |
| 111 | CVPL005W_1000330 | 3300002934 | Bacteria | 20563 |
| 112 | Ga0103265_1002195 | 3300007068 | Bacteria | 3036 |
| 113 | Ga0466706_236505 | 3300042599 | Bacteria | 51327 |
| 114 | Ga0466707_040731 | 3300042601 | Bacteria | 27571 |
| 115 | Ga0466716_471309 | 3300042605 | Bacteria | 4850 |
| 116 | Ga0466722_084379 | 3300042609 | Bacteria | 3471 |
| 117 | Ga0466710_085407 | 3300042613 | Bacteria | 1147 |
| 118 | Ga0466723_311353 | 3300042618 | Bacteria | 6242 |
| 119 | Ga0466728_220592 | 3300042620 | Bacteria | 2425 |
| 120 | Ga0466735_143225 | 3300042624 | Bacteria | 4461 |
| 121 | Ga0466708_137856 | 3300042652 | Bacteria | 16649 |
| 122 | Ga0466708_467274 | 3300042652 | Bacteria | 20579 |
| 123 | Ga0466727_136447 | 3300042655 | Bacteria | 4918 |
| 124 | Ga0466733_050154 | 3300042659 | Bacteria | 5726 |
| 125 | Ga0562374_0373 | 3300057007 | Bacteria | 82846 |
| 126 | Ga0466690_345743 | 3300042590 | Bacteria | 2966 |
| 127 | Ga0102739_1000376 | 3300007095 | Bacteria | 9731 |
| 128 | Ga0103267_1000212 | 3300007190 | Bacteria | 27107 |
| 129 | Ga0466722_225747 | 3300042609 | Bacteria | 9460 |
| 130 | Ga0466703_409606 | 3300042636 | Bacteria | 1627 |
| 131 | Ga0466704_077541 | 3300042643 | Bacteria | 7802 |
| 132 | Ga0466704_098298 | 3300042643 | Bacteria | 6068 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_406513 | Ga0466707_406513_4171_4830 | 193 |
| 2 | 3300000333 | HBC_ctgsDRAFT_1009566 | HBC_ctgsDRAFT_10095662 | 197 |
| 3 | 3300042596 | Ga0466696_506237 | Ga0466696_506237_1525_2190 | 197 |
| 4 | 3300042616 | Ga0466715_005011 | Ga0466715_005011_1261_1857 | 198 |
| 5 | 2035918003 | DPOL_contig00972 | DPOLB_2178140 | 201 |
| 6 | 3300007080 | Ga0102735_1001039 | Ga0102735_10010393 | 202 |
| 7 | 3300042612 | Ga0466705_241116 | Ga0466705_241116_3948_4595 | 203 |
| 8 | 3300042615 | Ga0466711_387227 | Ga0466711_387227_11741_12394 | 204 |
| 9 | 3300042636 | Ga0466703_084836 | Ga0466703_084836_12027_12662 | 204 |
| 10 | 3300042609 | Ga0466722_062829 | Ga0466722_062829_14791_15408 | 205 |
| 11 | 3300042618 | Ga0466723_271725 | Ga0466723_271725_105_755 | 205 |
| 12 | 3300042616 | Ga0466715_057350 | Ga0466715_057350_1253_1900 | 208 |
| 13 | 3300042636 | Ga0466703_043477 | Ga0466703_043477_653_1315 | 208 |
| 14 | 3300042648 | Ga0466709_081949 | Ga0466709_081949_77_721 | 208 |
| 15 | 3300005071 | Ga0068302_10020862 | Ga0068302_100208627 | 210 |
| 16 | 3300007188 | Ga0103264_1000692 | Ga0103264_100069218 | 210 |
| 17 | 3300002462 | JGI24702J35022_10139329 | JGI24702J35022_101393291 | 212 |
| 18 | 3300042599 | Ga0466706_236505 | Ga0466706_236505_1726_2364 | 212 |
| 19 | 3300042620 | Ga0466728_390106 | Ga0466728_390106_126_794 | 212 |
| 20 | 3300042619 | Ga0466726_155249 | Ga0466726_155249_354_995 | 213 |
| 21 | 3300042620 | Ga0466728_076186 | Ga0466728_076186_790_1431 | 213 |
| 22 | 3300042655 | Ga0466727_079697 | Ga0466727_079697_1219_1860 | 213 |
| 23 | iso_pr_bacteria | 2603880173 | 2606036820 | 213 |
| 24 | 3300002934 | CVPL005W_1000330 | CVPL005W_100033013 | 214 |
| 25 | 3300005071 | Ga0068302_10202601 | Ga0068302_102026012 | 214 |
| 26 | 3300007136 | Ga0104044_1151160 | Ga0104044_11511602 | 214 |
| 27 | 3300007139 | Ga0103260_1005040 | Ga0103260_10050402 | 214 |
| 28 | 3300007190 | Ga0103267_1000212 | Ga0103267_100021215 | 214 |
| 29 | 3300042590 | Ga0466690_052150 | Ga0466690_052150_14565_15209 | 214 |
| 30 | 3300042593 | Ga0466691_167953 | Ga0466691_167953_290_934 | 214 |
| 31 | 3300042601 | Ga0466707_034329 | Ga0466707_034329_4510_5154 | 214 |
| 32 | 3300042615 | Ga0466711_030594 | Ga0466711_030594_2497_3141 | 214 |
| 33 | 3300042618 | Ga0466723_311353 | Ga0466723_311353_2850_3494 | 214 |
| 34 | 3300042619 | Ga0466726_274018 | Ga0466726_274018_185_829 | 214 |
| 35 | 3300042624 | Ga0466735_090569 | Ga0466735_090569_1214_1858 | 214 |
| 36 | 3300042624 | Ga0466735_171398 | Ga0466735_171398_702_1346 | 214 |
| 37 | 3300042598 | Ga0466701_005914 | Ga0466701_005914_46615_47262 | 215 |
| 38 | 3300042599 | Ga0466706_099418 | Ga0466706_099418_6884_7531 | 215 |
| 39 | 3300042605 | Ga0466716_506150 | Ga0466716_506150_1803_2450 | 215 |
| 40 | 3300042606 | Ga0466719_493792 | Ga0466719_493792_41_688 | 215 |
| 41 | 3300042610 | Ga0466698_419105 | Ga0466698_419105_1870_2517 | 215 |
| 42 | 3300042612 | Ga0466705_119052 | Ga0466705_119052_4165_4812 | 215 |
| 43 | 3300042612 | Ga0466705_199437 | Ga0466705_199437_165_812 | 215 |
| 44 | 3300042616 | Ga0466715_050811 | Ga0466715_050811_565_1212 | 215 |
| 45 | 3300042616 | Ga0466715_086110 | Ga0466715_086110_387_1034 | 215 |
| 46 | 3300042616 | Ga0466715_206916 | Ga0466715_206916_8921_9568 | 215 |
| 47 | 3300042636 | Ga0466703_193733 | Ga0466703_193733_2280_2927 | 215 |
| 48 | 3300042636 | Ga0466703_255239 | Ga0466703_255239_13543_14190 | 215 |
| 49 | 3300042655 | Ga0466727_264886 | Ga0466727_264886_5134_5781 | 215 |
| 50 | 3300042659 | Ga0466733_080263 | Ga0466733_080263_586_1233 | 215 |
| 51 | iso_pr_bacteria | 2864764899 | 2864765724 | 215 |
| 52 | iso_pr_bacteria | 2864768727 | 2864770575 | 215 |
| 53 | iso_pr_bacteria | 2864791955 | 2864793809 | 215 |
| 54 | iso_pr_bacteria | 3007473699 | 3007474855 | 215 |
| 55 | 2225789004 | 2227474936 | 2227925964 | 216 |
| 56 | 3300000062 | IMNBL1DRAFT_c0001060 | IMNBL1DRAFT_00010602 | 216 |
| 57 | 3300002504 | JGI24705J35276_12234812 | JGI24705J35276_122348122 | 216 |
| 58 | 3300042591 | Ga0466692_072596 | Ga0466692_072596_15007_15657 | 216 |
| 59 | 3300042605 | Ga0466716_237078 | Ga0466716_237078_3424_4074 | 216 |
| 60 | 3300042605 | Ga0466716_476877 | Ga0466716_476877_3459_4109 | 216 |
| 61 | 3300042606 | Ga0466719_026740 | Ga0466719_026740_2296_2946 | 216 |
| 62 | 3300042606 | Ga0466719_497203 | Ga0466719_497203_26524_27174 | 216 |
| 63 | 3300042609 | Ga0466722_084379 | Ga0466722_084379_756_1406 | 216 |
| 64 | 3300042612 | Ga0466705_023779 | Ga0466705_023779_6144_6794 | 216 |
| 65 | 3300042620 | Ga0466728_220592 | Ga0466728_220592_493_1143 | 216 |
| 66 | 3300042621 | Ga0466729_132295 | Ga0466729_132295_208_858 | 216 |
| 67 | 3300042621 | Ga0466729_230531 | Ga0466729_230531_599_1249 | 216 |
| 68 | 3300042621 | Ga0466729_287403 | Ga0466729_287403_581_1231 | 216 |
| 69 | 3300042624 | Ga0466735_181811 | Ga0466735_181811_5421_6071 | 216 |
| 70 | 3300042624 | Ga0466735_228417 | Ga0466735_228417_11727_12377 | 216 |
| 71 | 3300042636 | Ga0466703_132322 | Ga0466703_132322_572_1222 | 216 |
| 72 | 3300042643 | Ga0466704_077541 | Ga0466704_077541_1002_1697 | 216 |
| 73 | 3300042643 | Ga0466704_098298 | Ga0466704_098298_261_911 | 216 |
| 74 | 3300042652 | Ga0466708_467274 | Ga0466708_467274_18881_19531 | 216 |
| 75 | 3300042655 | Ga0466727_168732 | Ga0466727_168732_3356_4006 | 216 |
| 76 | iso_pr_bacteria | 2832343623 | 2832345695 | 216 |
| 77 | iso_pr_bacteria | 2832372155 | 2832372362 | 216 |
| 78 | iso_pr_bacteria | 643348524 | 643422847 | 216 |
| 79 | 2225789004 | 2227566589 | 2228108665 | 217 |
| 80 | 2225789004 | 2227599071 | 2228163568 | 217 |
| 81 | 3300007068 | Ga0103265_1002844 | Ga0103265_10028444 | 217 |
| 82 | 3300007083 | Ga0103261_1004997 | Ga0103261_10049972 | 217 |
| 83 | 3300007142 | Ga0102737_1004722 | Ga0102737_10047223 | 217 |
| 84 | 3300007192 | Ga0103268_1000936 | Ga0103268_10009363 | 217 |
| 85 | 3300042590 | Ga0466690_433579 | Ga0466690_433579_840_1493 | 217 |
| 86 | 3300042592 | Ga0466693_355438 | Ga0466693_355438_576_1229 | 217 |
| 87 | 3300042605 | Ga0466716_524202 | Ga0466716_524202_2334_2987 | 217 |
| 88 | 3300042609 | Ga0466722_225747 | Ga0466722_225747_8673_9326 | 217 |
| 89 | 3300042615 | Ga0466711_015732 | Ga0466711_015732_1794_2447 | 217 |
| 90 | 3300042615 | Ga0466711_466224 | Ga0466711_466224_479_1132 | 217 |
| 91 | 3300042618 | Ga0466723_044466 | Ga0466723_044466_3536_4189 | 217 |
| 92 | 3300042636 | Ga0466703_409606 | Ga0466703_409606_287_940 | 217 |
| 93 | 3300042648 | Ga0466709_267822 | Ga0466709_267822_5925_6578 | 217 |
| 94 | 3300042652 | Ga0466708_137856 | Ga0466708_137856_10359_11012 | 217 |
| 95 | iso_pr_bacteria | 2785510743 | 2785734857 | 217 |
| 96 | iso_pr_bacteria | 2799112231 | 2799232811 | 217 |
| 97 | iso_pr_bacteria | 2832298047 | 2832298878 | 217 |
| 98 | iso_pr_bacteria | 2864777284 | 2864779912 | 217 |
| 99 | iso_pr_bacteria | 2864796242 | 2864799189 | 217 |
| 100 | 3300000062 | IMNBL1DRAFT_c0003566 | IMNBL1DRAFT_00035662 | 218 |
| 101 | 3300000333 | HBC_ctgsDRAFT_1000443 | HBC_ctgsDRAFT_100044310 | 218 |
| 102 | 3300002462 | JGI24702J35022_10022311 | JGI24702J35022_100223113 | 218 |
| 103 | 3300002462 | JGI24702J35022_10079866 | JGI24702J35022_100798662 | 218 |
| 104 | 3300042598 | Ga0466701_075119 | Ga0466701_075119_4439_5095 | 218 |
| 105 | 3300042613 | Ga0466710_085407 | Ga0466710_085407_453_1109 | 218 |
| 106 | 3300042616 | Ga0466715_120539 | Ga0466715_120539_7065_7721 | 218 |
| 107 | 3300042616 | Ga0466715_565336 | Ga0466715_565336_9432_10088 | 218 |
| 108 | 3300042618 | Ga0466723_030264 | Ga0466723_030264_1859_2515 | 218 |
| 109 | 3300042624 | Ga0466735_143225 | Ga0466735_143225_2672_3328 | 218 |
| 110 | 3300042643 | Ga0466704_109326 | Ga0466704_109326_1463_2119 | 218 |
| 111 | iso_pr_bacteria | 2820762746 | 2820764202 | 218 |
| 112 | 3300002462 | JGI24702J35022_10011816 | JGI24702J35022_100118162 | 219 |
| 113 | 3300002509 | JGI24699J35502_11134134 | JGI24699J35502_1113413436 | 219 |
| 114 | 3300005083 | Ga0068305_10019290 | Ga0068305_100192904 | 219 |
| 115 | 3300042590 | Ga0466690_055481 | Ga0466690_055481_32056_32715 | 219 |
| 116 | 3300042590 | Ga0466690_064779 | Ga0466690_064779_740_1399 | 219 |
| 117 | 3300042590 | Ga0466690_345743 | Ga0466690_345743_395_1054 | 219 |
| 118 | 3300042601 | Ga0466707_040731 | Ga0466707_040731_7455_8114 | 219 |
| 119 | 3300042652 | Ga0466708_301949 | Ga0466708_301949_18928_19587 | 219 |
| 120 | iso_pr_bacteria | 2695420317 | 2695485857 | 219 |
| 121 | iso_pr_bacteria | 2873600114 | 2873603392 | 219 |
| 122 | iso_pr_bacteria | 2873610414 | 2873613786 | 219 |
| 123 | iso_pr_bacteria | 8100157865 | 8100161185 | 219 |
| 124 | 2225789004 | 2227145542 | 2227549246 | 220 |
| 125 | 3300042591 | Ga0466692_157530 | Ga0466692_157530_945_1607 | 220 |
| 126 | 3300042606 | Ga0466719_021038 | Ga0466719_021038_3512_4174 | 220 |
| 127 | 3300042612 | Ga0466705_474695 | Ga0466705_474695_9889_10551 | 220 |
| 128 | 3300042616 | Ga0466715_056569 | Ga0466715_056569_19776_20438 | 220 |
| 129 | 3300042620 | Ga0466728_200812 | Ga0466728_200812_2092_2754 | 220 |
| 130 | 3300042655 | Ga0466727_136447 | Ga0466727_136447_175_837 | 220 |
| 131 | 3300042659 | Ga0466733_050154 | Ga0466733_050154_278_940 | 220 |
| 132 | iso_pr_bacteria | 2940193328 | 2940193924 | 221 |
| 133 | iso_pr_bacteria | 2940336608 | 2940337202 | 221 |
| 134 | 3300007067 | Ga0103266_1000115 | Ga0103266_100011512 | 222 |
| 135 | 3300007068 | Ga0103265_1002195 | Ga0103265_10021953 | 222 |
| 136 | 3300042643 | Ga0466704_179826 | Ga0466704_179826_792_1508 | 222 |
| 137 | iso_pr_bacteria | 2548876931 | 2550376584 | 222 |
| 138 | iso_pr_bacteria | 2687453754 | 2690040493 | 222 |
| 139 | iso_pr_bacteria | 2687453755 | 2690045159 | 222 |
| 140 | iso_pr_bacteria | 2687453756 | 2690045964 | 222 |
| 141 | iso_pr_bacteria | 644736334 | 644772358 | 222 |
| 142 | 3300002732 | WW0001_100248 | WW0001_10024893 | 223 |
| 143 | 3300007052 | Ga0102736_1001776 | Ga0102736_10017762 | 223 |
| 144 | 3300007095 | Ga0102739_1000376 | Ga0102739_10003767 | 223 |
| 145 | 3300010217 | Ga0136159_1000020 | Ga0136159_100002065 | 223 |
| 146 | 3300042592 | Ga0466693_331635 | Ga0466693_331635_1390_2061 | 223 |
| 147 | 3300042659 | Ga0466733_034755 | Ga0466733_034755_2742_3413 | 223 |
| 148 | 3300057007 | Ga0562374_0373 | Ga0562374_0373_67509_68180 | 223 |
| 149 | 3300042601 | Ga0466707_231574 | Ga0466707_231574_7970_8644 | 224 |
| 150 | 3300042621 | Ga0466729_226092 | Ga0466729_226092_3252_3926 | 224 |
| 151 | 3300042591 | Ga0466692_188243 | Ga0466692_188243_3933_4610 | 225 |
| 152 | 3300042605 | Ga0466716_471309 | Ga0466716_471309_2255_2935 | 226 |
| 153 | 3300007129 | Ga0102734_1006182 | Ga0102734_10061822 | 227 |
| 154 | 3300042649 | Ga0466724_50202 | Ga0466724_50202_3683_4369 | 228 |
| 155 | iso_pr_bacteria | 2850131454 | 2850133239 | 228 |
| 156 | 3300042603 | Ga0466714_105572 | Ga0466714_105572_1336_2028 | 230 |
| 157 | 3300042601 | Ga0466707_058054 | Ga0466707_058054_194_889 | 231 |
| 158 | 3300042636 | Ga0466703_240214 | Ga0466703_240214_995_1714 | 239 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09335 | VTT_dom | VTT domain | 73 | 200 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.72 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.