Protein Family IF09199

Metagenome Isolate
119 Members
43 Samples
113 Scaffolds
363.8 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_212183|Ga0466703_212183_584_1891
Length
413 aa
Sequence
MKKQPDTSIREAQAEIGPKIRTKVLSPGNYPLQIAGRTPLKPVKPWAVFFLALGIGVCAFAGGSKDSGKGPAASGQSGGKSSTDTLKVGFVYIGAINDEGYTQAHDKGRLAIEALGIKTAYIENVAENADCEKAIRDLIDQGCNVIYTNSFGFMDWTIKVAADNPSVYFGHCSGYKRAANVSTYFGKIYQARYLSGIVAGLKTTANHIGYVAAMPIPEVIRGINAFTLGVQSVNPEATVEVIWTNTWYDPSVEKQAALELLNQGCDVIAQHQDTTAPQIAAQERGAFAVGYNVPTASAAPRAYLTAPLFHWEVFYLDDVKSILAGTWKSRAYWEGFSNGTVSLDTLTGNNAPETAEKIAEVKTQIIEGAFDPFTGPLTDQGGTLKVASGVKMSDDEIWNMSWFVQGVIGTIPQ

📊 Sample Types

Isolate 5.0%
Metagenome 95.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 33.3%
Termitidae 31.0%
Unclassified 21.4%
Termopsidae 7.1%
Rhinotermitidae 7.1%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
2 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
3 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
4 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
5 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
34 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_078857 3300042612 Bacteria 8457
2 Ga0466723_053639 3300042618 Bacteria 12699
3 Ga0466723_153797 3300042618 Bacteria 5760
4 JGI24698J34947_10004085 3300002449 Bacteria 7915
5 Ga0466703_212183 3300042636 Bacteria 5649
6 Ga0466704_459937 3300042643 Bacteria 17868
7 Ga0466727_200820 3300042655 Bacteria 4826
8 Ga0123353_10000006 3300010167 Bacteria 279423
9 Ga0466690_090833 3300042590 Bacteria 11508
10 Ga0466690_274431 3300042590 Bacteria 6570
11 Ga0466691_023198 3300042593 Bacteria 6090
12 Ga0466691_146404 3300042593 Bacteria 1412
13 Ga0466694_243185 3300042594 Bacteria 1327
14 Ga0466719_514470 3300042606 Bacteria 1585
15 Ga0466698_071886 3300042610 Bacteria 1601
16 Ga0466711_077883 3300042615 Bacteria 2655
17 Ga0466711_194219 3300042615 Bacteria 2013
18 Ga0466715_169434 3300042616 Bacteria 34287
19 Ga0466715_236808 3300042616 Bacteria 11381
20 Ga0466723_240797 3300042618 Bacteria 40146
21 Ga0466726_123362 3300042619 Bacteria 2727
22 Ga0466726_308624 3300042619 Bacteria 2957
23 JGI24698J34947_10005738 3300002449 Bacteria 6806
24 JGI24698J34947_10043068 3300002449 Bacteria 2316
25 JGI24695J34938_10010109 3300002450 Bacteria 5198
26 Ga0466735_205567 3300042624 Bacteria 2147
27 Ga0466703_377616 3300042636 Bacteria 7547
28 Ga0466709_195623 3300042648 Bacteria 12818
29 Ga0466690_098884 3300042590 Bacteria 9534
30 Ga0466690_101534 3300042590 Bacteria 2985
31 Ga0466691_133139 3300042593 Bacteria 14278
32 Ga0466691_221782 3300042593 Bacteria 4832
33 Ga0466696_426519 3300042596 Bacteria 1767
34 Ga0466699_013938 3300042597 Bacteria 12819
35 Ga0466699_049632 3300042597 Bacteria 9016
36 Ga0466716_025395 3300042605 Bacteria 11916
37 Ga0466720_055001 3300042607 Bacteria 5024
38 Ga0466720_179624 3300042607 Bacteria 23019
39 Ga0466722_122485 3300042609 Bacteria 7407
40 JGI24698J34947_10029707 3300002449 Unclassified 2886
41 JGI24698J34947_10043943 3300002449 Bacteria 2288
42 JGI24702J35022_10028721 3300002462 Bacteria 2987
43 Ga0072941_1005277 3300005201 Bacteria 11744
44 Ga0456237_0002461 3300041968 Unclassified 2998
45 Ga0466690_072249 3300042590 Bacteria 6881
46 Ga0466692_043079 3300042591 Bacteria 14219
47 Ga0466691_050216 3300042593 Unclassified 6367
48 Ga0466732_428542 3300042656 Bacteria 3624
49 Ga0466712_206989 3300042614 Bacteria 5924
50 Ga0466726_239069 3300042619 Bacteria 26158
51 Ga0466726_286331 3300042619 Bacteria 1360
52 Ga0466703_044208 3300042636 Bacteria 3431
53 Ga0466703_265917 3300042636 Bacteria 4816
54 Ga0466704_103233 3300042643 Bacteria 3356
55 Ga0466709_275987 3300042648 Bacteria 16469
56 Ga0466727_041444 3300042655 Bacteria 5903
57 Ga0466690_105467 3300042590 Bacteria 2922
58 Ga0466692_093202 3300042591 Bacteria 5806
59 Ga0466691_046864 3300042593 Bacteria 7165
60 Ga0466699_117847 3300042597 Bacteria 18652
61 Ga0466699_303477 3300042597 Bacteria 2916
62 Ga0466719_062250 3300042606 Bacteria 5475
63 Ga0466705_050529 3300042612 Bacteria 30966
64 Ga0466718_070913 3300042617 Unclassified 8015
65 Ga0466726_447172 3300042619 Bacteria 5944
66 Ga0466728_101046 3300042620 Bacteria 27672
67 Ga0466728_190199 3300042620 Bacteria 4446
68 Ga0466728_227552 3300042620 Bacteria 12367
69 JGI24698J34947_10024966 3300002449 Bacteria 3185
70 JGI24702J35022_10015248 3300002462 Bacteria 4234
71 Ga0466704_202319 3300042643 Bacteria 1418
72 Ga0466727_237172 3300042655 Bacteria 27933
73 Ga0466696_454256 3300042596 Bacteria 1458
74 Ga0466699_002180 3300042597 Bacteria 1675
75 Ga0466713_025359 3300042602 Bacteria 8367
76 Ga0466722_007201 3300042609 Bacteria 2163
77 Ga0466712_239992 3300042614 Bacteria 2392
78 Ga0466711_060677 3300042615 Bacteria 10656
79 JGI24698J34947_10001072 3300002449 Bacteria 14070
80 JGI24698J34947_10006776 3300002449 Bacteria 6293
81 JGI24698J34947_10028422 3300002449 Unclassified 2960
82 Ga0068305_10142616 3300005083 Bacteria 9272
83 Ga0466704_094999 3300042643 Bacteria 61949
84 Ga0466704_587653 3300042643 Bacteria 3258
85 Ga0466708_315814 3300042652 Bacteria 5410
86 Ga0466707_351736 3300042601 Bacteria 1593
87 Ga0466717_144307 3300042604 Bacteria 1828
88 Ga0466719_059333 3300042606 Bacteria 11720
89 Ga0466712_322406 3300042614 Bacteria 2880
90 Ga0466711_168924 3300042615 Bacteria 2419
91 Ga0466711_245930 3300042615 Bacteria 4889
92 Ga0466723_194380 3300042618 Bacteria 46497
93 Ga0466723_229778 3300042618 Bacteria 6132
94 Ga0466726_193769 3300042619 Bacteria 2793
95 JGI24698J34947_10002749 3300002449 Bacteria 9517
96 JGI24698J34947_10008242 3300002449 Bacteria 5715
97 JGI24698J34947_10061850 3300002449 Unclassified 1840
98 JGI24699J35502_11132041 3300002509 Bacteria 6316
99 Ga0466703_011851 3300042636 Bacteria 33424
100 Ga0466709_265919 3300042648 Bacteria 4899
101 Ga0466720_153412 3300042607 Bacteria 30506
102 Ga0466698_318527 3300042610 Bacteria 5599
103 Ga0466732_114340 3300042656 Bacteria 7098
104 Ga0466715_428201 3300042616 Bacteria 1502
105 Ga0466726_248436 3300042619 Bacteria 16954
106 JGI24698J34947_10017061 3300002449 Bacteria 3938
107 JGI24698J34947_10028453 3300002449 Bacteria 2958
108 Ga0466703_021634 3300042636 Bacteria 2949
109 Ga0466704_116351 3300042643 Bacteria 6593
110 Ga0466704_186473 3300042643 Bacteria 5098
111 Ga0466709_307458 3300042648 Bacteria 20760
112 Ga0123353_10049238 3300010167 Bacteria 6712
113 Ga0466707_238514 3300042601 Bacteria 1782

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_070913 Ga0466718_070913_4721_5815 332
2 3300042636 Ga0466703_011851 Ga0466703_011851_1401_2408 335
3 3300042643 Ga0466704_094999 Ga0466704_094999_41904_43031 335
4 3300042618 Ga0466723_153797 Ga0466723_153797_464_1531 337
5 3300002449 JGI24698J34947_10043068 JGI24698J34947_100430682 341
6 3300042616 Ga0466715_169434 Ga0466715_169434_24296_25399 343
7 3300042591 Ga0466692_093202 Ga0466692_093202_2230_3348 344
8 3300042593 Ga0466691_133139 Ga0466691_133139_3924_5021 347
9 3300002449 JGI24698J34947_10006776 JGI24698J34947_100067763 350
10 3300002450 JGI24695J34938_10010109 JGI24695J34938_100101094 350
11 3300042593 Ga0466691_046864 Ga0466691_046864_3508_4641 350
12 3300042604 Ga0466717_144307 Ga0466717_144307_201_1289 350
13 3300042615 Ga0466711_077883 Ga0466711_077883_1384_2475 350
14 3300042643 Ga0466704_587653 Ga0466704_587653_1061_2155 350
15 3300042656 Ga0466732_428542 Ga0466732_428542_290_1423 350
16 3300042590 Ga0466690_072249 Ga0466690_072249_4658_5755 351
17 3300042601 Ga0466707_351736 Ga0466707_351736_456_1550 352
18 3300042606 Ga0466719_062250 Ga0466719_062250_4093_5157 354
19 3300002462 JGI24702J35022_10028721 JGI24702J35022_100287212 355
20 3300010167 Ga0123353_10049238 Ga0123353_100492382 355
21 3300042597 Ga0466699_013938 Ga0466699_013938_515_1660 355
22 3300042619 Ga0466726_239069 Ga0466726_239069_13999_15069 356
23 3300042648 Ga0466709_307458 Ga0466709_307458_19359_20429 356
24 3300042655 Ga0466727_041444 Ga0466727_041444_4601_5671 356
25 3300002449 JGI24698J34947_10028422 JGI24698J34947_100284223 357
26 3300042590 Ga0466690_090833 Ga0466690_090833_1841_2938 357
27 3300042593 Ga0466691_023198 Ga0466691_023198_1230_2330 357
28 3300002449 JGI24698J34947_10004085 JGI24698J34947_100040853 358
29 3300042616 Ga0466715_236808 Ga0466715_236808_63_1139 358
30 3300042606 Ga0466719_514470 Ga0466719_514470_228_1340 359
31 3300042615 Ga0466711_060677 Ga0466711_060677_4194_5273 359
32 3300042619 Ga0466726_193769 Ga0466726_193769_1303_2415 359
33 3300042624 Ga0466735_205567 Ga0466735_205567_421_1515 359
34 3300042614 Ga0466712_206989 Ga0466712_206989_4564_5757 360
35 3300002449 JGI24698J34947_10017061 JGI24698J34947_100170612 361
36 3300005083 Ga0068305_10142616 Ga0068305_101426167 361
37 3300042597 Ga0466699_002180 Ga0466699_002180_487_1572 361
38 3300042614 Ga0466712_322406 Ga0466712_322406_282_1367 361
39 3300042643 Ga0466704_103233 Ga0466704_103233_133_1218 361
40 iso_pr_bacteria 2781125689 2781426164 361
41 3300002449 JGI24698J34947_10001072 JGI24698J34947_100010728 362
42 3300002449 JGI24698J34947_10024966 JGI24698J34947_100249662 362
43 3300002449 JGI24698J34947_10029707 JGI24698J34947_100297072 362
44 3300002509 JGI24699J35502_11132041 JGI24699J35502_111320413 362
45 3300042590 Ga0466690_098884 Ga0466690_098884_7520_8650 362
46 3300042607 Ga0466720_153412 Ga0466720_153412_2592_3698 362
47 3300042610 Ga0466698_318527 Ga0466698_318527_2819_3907 362
48 3300042593 Ga0466691_146404 Ga0466691_146404_78_1169 363
49 3300042596 Ga0466696_454256 Ga0466696_454256_14_1105 363
50 3300042616 Ga0466715_428201 Ga0466715_428201_163_1254 363
51 3300042619 Ga0466726_447172 Ga0466726_447172_3301_4392 363
52 3300042636 Ga0466703_265917 Ga0466703_265917_653_1744 363
53 3300042656 Ga0466732_114340 Ga0466732_114340_5089_6180 363
54 iso_pr_bacteria 2781125687 2781421597 363
55 3300002449 JGI24698J34947_10002749 JGI24698J34947_100027492 364
56 3300042594 Ga0466694_243185 Ga0466694_243185_110_1204 364
57 3300042597 Ga0466699_049632 Ga0466699_049632_5026_6120 364
58 3300042597 Ga0466699_117847 Ga0466699_117847_6552_7646 364
59 3300042607 Ga0466720_055001 Ga0466720_055001_1681_2775 364
60 3300042607 Ga0466720_179624 Ga0466720_179624_5624_6718 364
61 3300042610 Ga0466698_071886 Ga0466698_071886_28_1122 364
62 3300042614 Ga0466712_239992 Ga0466712_239992_366_1460 364
63 3300042643 Ga0466704_116351 Ga0466704_116351_965_2059 364
64 3300042643 Ga0466704_186473 Ga0466704_186473_431_1525 364
65 3300042643 Ga0466704_202319 Ga0466704_202319_87_1181 364
66 iso_pr_bacteria 2781125696 2781441290 364
67 3300002449 JGI24698J34947_10005738 JGI24698J34947_100057383 365
68 3300002449 JGI24698J34947_10008242 JGI24698J34947_100082422 365
69 3300002449 JGI24698J34947_10043943 JGI24698J34947_100439432 365
70 3300002449 JGI24698J34947_10061850 JGI24698J34947_100618502 365
71 3300002462 JGI24702J35022_10015248 JGI24702J35022_100152482 365
72 3300005201 Ga0072941_1005277 Ga0072941_10052775 365
73 3300042593 Ga0466691_221782 Ga0466691_221782_3483_4580 365
74 3300042597 Ga0466699_303477 Ga0466699_303477_116_1213 365
75 3300042612 Ga0466705_078857 Ga0466705_078857_7155_8252 365
76 3300042655 Ga0466727_200820 Ga0466727_200820_2249_3346 365
77 3300042615 Ga0466711_194219 Ga0466711_194219_732_1832 366
78 3300042619 Ga0466726_123362 Ga0466726_123362_1267_2367 366
79 3300042648 Ga0466709_265919 Ga0466709_265919_36_1136 366
80 iso_pr_bacteria 2781125695 2781439657 366
81 3300041968 Ga0456237_0002461 Ga0456237_0002461_1740_2843 367
82 3300042609 Ga0466722_007201 Ga0466722_007201_121_1224 367
83 3300042615 Ga0466711_245930 Ga0466711_245930_307_1410 367
84 3300042620 Ga0466728_190199 Ga0466728_190199_1290_2393 367
85 3300042596 Ga0466696_426519 Ga0466696_426519_498_1604 368
86 3300042602 Ga0466713_025359 Ga0466713_025359_4409_5515 368
87 3300042609 Ga0466722_122485 Ga0466722_122485_6241_7347 368
88 3300042643 Ga0466704_459937 Ga0466704_459937_4145_5251 368
89 3300002449 JGI24698J34947_10028453 JGI24698J34947_100284532 369
90 3300042615 Ga0466711_168924 Ga0466711_168924_449_1594 369
91 3300042648 Ga0466709_195623 Ga0466709_195623_193_1302 369
92 3300042590 Ga0466690_101534 Ga0466690_101534_373_1485 370
93 3300042618 Ga0466723_053639 Ga0466723_053639_9192_10304 370
94 3300042655 Ga0466727_237172 Ga0466727_237172_18418_19530 370
95 3300042605 Ga0466716_025395 Ga0466716_025395_5833_6948 371
96 3300042618 Ga0466723_240797 Ga0466723_240797_35398_36513 371
97 3300042619 Ga0466726_286331 Ga0466726_286331_138_1253 371
98 3300042620 Ga0466728_227552 Ga0466728_227552_7407_8522 371
99 3300042648 Ga0466709_275987 Ga0466709_275987_10887_12002 371
100 3300042590 Ga0466690_274431 Ga0466690_274431_311_1429 372
101 3300042591 Ga0466692_043079 Ga0466692_043079_10381_11499 372
102 3300042593 Ga0466691_050216 Ga0466691_050216_817_1935 372
103 3300042636 Ga0466703_021634 Ga0466703_021634_812_1930 372
104 3300042636 Ga0466703_377616 Ga0466703_377616_3385_4503 372
105 3300042652 Ga0466708_315814 Ga0466708_315814_56_1174 372
106 3300042590 Ga0466690_105467 Ga0466690_105467_1542_2663 373
107 3300042612 Ga0466705_050529 Ga0466705_050529_557_1678 373
108 3300042618 Ga0466723_194380 Ga0466723_194380_1178_2299 373
109 3300042618 Ga0466723_229778 Ga0466723_229778_51_1172 373
110 3300042619 Ga0466726_308624 Ga0466726_308624_402_1526 374
111 3300042606 Ga0466719_059333 Ga0466719_059333_7543_8676 377
112 3300042620 Ga0466728_101046 Ga0466728_101046_3772_4905 377
113 3300042636 Ga0466703_044208 Ga0466703_044208_2111_3250 379
114 3300042601 Ga0466707_238514 Ga0466707_238514_213_1403 382
115 3300042619 Ga0466726_248436 Ga0466726_248436_3638_4828 396
116 iso_pr_bacteria 2820432912 2820433050 399
117 iso_pr_bacteria 2820530790 2820531140 399
118 3300010167 Ga0123353_10000006 Ga0123353_10000006142 400
119 3300042636 Ga0466703_212183 Ga0466703_212183_584_1891 413

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02608 Bmp ABC transporter substrate-binding protein PnrA-like 87 367 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02608 GO:0005886 plasma membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.