Protein Family IF09190

Metagenome Isolate
133 Members
46 Samples
126 Scaffolds
405.13 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_199111|Ga0466703_199111_1024_2385
Length
453 aa
Sequence
MTKQQFVEWAGLNNGKKYVWVKYLYFQIKFVPLQPNVSMIMSKIKIKNFGPIKSGFQGNGGWLEINKVTVFVGNQGSGKSTVAKLISIFTKIEKSLVRGDFEKDWFEVKNRLKSYYLPYHRLEDYLNDNSEIEYIGNKFSITYKNEKLVVNEIQNSAYSLPKIMYVPAERNLLTYIKGAEELKLSSEALQEFSTEYYSAMQEMNGDVILLPINDTEIRYDKRSDELYLKSSDFRIKLRVASSGFQSFVPLYLVSDYLANSVKQQSGKKAAMSSEETVKFQKGLRTIWDNEHLTDIQKRQAISELASAFNKTAFVNIVEEPEQNLFPSSQWQMLQSLLALNNMNIGNKLIMTTHSPYLINYLTIAIKAKQVFDSLSKNKKEVLSSAISNLINLNSCTNADGVSIYEMEEKTGIIKSLPKYNDLIPSDDNFLNNMLADTNNLFAELQEIEEENEN

📊 Sample Types

Isolate 5.3%
Metagenome 94.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.1%
Termitidae 22.2%
Termopsidae 8.9%
Rhinotermitidae 8.9%
Coreidae 8.9%
Unclassified 6.7%
Blattidae 4.4%
Passalidae 4.4%
Curculionidae 2.2%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3004677695 Bacteroides sp. 214 Isolate Blattidae
12 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
13 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
14 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
15 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 2922326829 Bacteroides sp. 224 Isolate Blattidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
43 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
44 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
45 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_010159 3300042612 Bacteria 2042
2 Ga0466705_193544 3300042612 Unclassified 2120
3 JGI24705J35276_12219288 3300002504 Bacteria 2196
4 Ga0466711_036318 3300042615 Bacteria 24493
5 Ga0466711_203198 3300042615 Bacteria 14642
6 Ga0466711_248007 3300042615 Bacteria 2748
7 Ga0466723_166508 3300042618 Bacteria 1942
8 Ga0466726_315192 3300042619 Bacteria 6957
9 Ga0466729_063125 3300042621 Bacteria 2278
10 Ga0123356_10003262 3300010049 Bacteria 17030
11 Ga0466704_376545 3300042643 Unclassified 1838
12 Ga0466709_413906 3300042648 Bacteria 1431
13 Ga0466708_107621 3300042652 Bacteria 7616
14 Ga0466727_155234 3300042655 Bacteria 2037
15 Ga0466707_197531 3300042601 Bacteria 3179
16 Ga0466719_219253 3300042606 Bacteria 5709
17 Ga0466719_264746 3300042606 Bacteria 1716
18 Ga0466698_115857 3300042610 Bacteria 1304
19 Ga0466690_125787 3300042590 Unclassified 3564
20 Ga0466691_048607 3300042593 Bacteria 2780
21 2227560451 2225789004 Bacteria 2731
22 Ga0466711_047599 3300042615 Bacteria 5202
23 Ga0466711_071126 3300042615 Bacteria 3021
24 Ga0466711_143374 3300042615 Bacteria 19009
25 Ga0466728_036084 3300042620 Bacteria 3220
26 Ga0466728_141051 3300042620 Bacteria 14388
27 Ga0466704_128923 3300042643 Unclassified 2781
28 Ga0466704_300905 3300042643 Bacteria 2512
29 Ga0466704_619673 3300042643 Bacteria 2318
30 Ga0466709_087182 3300042648 Bacteria 32518
31 Ga0466709_229995 3300042648 Unclassified 7365
32 Ga0466709_405046 3300042648 Unclassified 4224
33 Ga0466727_274265 3300042655 Bacteria 3348
34 Ga0466716_380175 3300042605 Bacteria 6615
35 Ga0466690_006502 3300042590 Bacteria 4922
36 Ga0466691_003671 3300042593 Bacteria 2014
37 Ga0466694_221801 3300042594 Bacteria 1327
38 Ga0466705_091653 3300042612 Bacteria 4650
39 Ga0466705_134441 3300042612 Bacteria 2227
40 Ga0068302_10074303 3300005071 Bacteria 10727
41 Ga0466729_016304 3300042621 Bacteria 11150
42 Ga0466729_239873 3300042621 Unclassified 1944
43 Ga0466704_079855 3300042643 Bacteria 3567
44 Ga0466716_032962 3300042605 Bacteria 44870
45 Ga0466722_129458 3300042609 Bacteria 1805
46 Ga0466691_018446 3300042593 Bacteria 28676
47 Ga0466696_066912 3300042596 Bacteria 3210
48 Ga0466696_141945 3300042596 Bacteria 13688
49 Ga0466705_512278 3300042612 Bacteria 3208
50 Ga0466711_508885 3300042615 Bacteria 1593
51 Ga0466729_097238 3300042621 Bacteria 11917
52 Ga0466729_298784 3300042621 Bacteria 3193
53 Ga0466735_197405 3300042624 Unclassified 1728
54 Ga0466704_443177 3300042643 Bacteria 2388
55 Ga0466727_102193 3300042655 Bacteria 19122
56 Ga0466706_095663 3300042599 Bacteria 79833
57 Ga0466707_421264 3300042601 Bacteria 2607
58 Ga0466713_131141 3300042602 Bacteria 6328
59 Ga0466691_028163 3300042593 Bacteria 8650
60 Ga0466691_066219 3300042593 Bacteria 2306
61 Ga0466696_171842 3300042596 Unclassified 2646
62 Ga0466705_027418 3300042612 Unclassified 15109
63 Ga0466733_104370 3300042659 Bacteria 2375
64 Ga0072940_1113583 3300005200 Unclassified 1783
65 Ga0466728_181915 3300042620 Bacteria 2717
66 Ga0466735_053874 3300042624 Bacteria 2150
67 Ga0466703_123754 3300042636 Bacteria 2095
68 Ga0466708_101658 3300042652 Bacteria 1451
69 Ga0466727_044337 3300042655 Bacteria 1748
70 Ga0466707_135188 3300042601 Bacteria 4322
71 Ga0466716_162491 3300042605 Bacteria 1341
72 Ga0466719_260343 3300042606 Bacteria 3779
73 Ga0466691_081639 3300042593 Bacteria 33689
74 2227122472 2225789004 Bacteria 9157
75 IMNBL1DRAFT_c0031195 3300000062 Unclassified 1942
76 Ga0466715_275902 3300042616 Bacteria 1887
77 Ga0466715_551893 3300042616 Bacteria 1818
78 Ga0466729_023152 3300042621 Bacteria 5164
79 Ga0123356_10596089 3300010049 Bacteria 1269
80 Ga0123354_10045202 3300010882 Bacteria 6742
81 Ga0466703_199437 3300042636 Bacteria 5347
82 Ga0466704_258320 3300042643 Bacteria 11896
83 Ga0466727_170957 3300042655 Bacteria 2476
84 Ga0466727_235906 3300042655 Bacteria 2187
85 Ga0466706_175765 3300042599 Bacteria 6049
86 Ga0466716_159181 3300042605 Bacteria 5411
87 Ga0466722_126114 3300042609 Bacteria 15006
88 Ga0466690_031683 3300042590 Bacteria 5617
89 Ga0466696_206364 3300042596 Bacteria 2250
90 Ga0466696_464269 3300042596 Bacteria 6058
91 Ga0466705_027962 3300042612 Bacteria 3854
92 Ga0466705_145068 3300042612 Bacteria 3429
93 Ga0466705_215741 3300042612 Bacteria 2081
94 Ga0466732_043598 3300042656 Bacteria 56649
95 Ga0466733_144534 3300042659 Bacteria 4992
96 JGI24705J35276_12218485 3300002504 Bacteria 2147
97 Ga0068305_10185401 3300005083 Bacteria 2267
98 Ga0466723_226270 3300042618 Bacteria 26023
99 Ga0466726_197104 3300042619 Bacteria 6399
100 Ga0466728_019446 3300042620 Bacteria 2301
101 Ga0123356_10002936 3300010049 Unclassified 18046
102 Ga0466703_108731 3300042636 Bacteria 1689
103 Ga0466703_199111 3300042636 Bacteria 2536
104 Ga0466704_575626 3300042643 Bacteria 2166
105 Ga0466724_53887 3300042649 Bacteria 97080
106 Ga0466708_220833 3300042652 Bacteria 2143
107 Ga0466707_250571 3300042601 Bacteria 3862
108 Ga0466707_333511 3300042601 Bacteria 1407
109 Ga0466716_222953 3300042605 Bacteria 3199
110 Ga0415639_060692 3300038395 Bacteria 8444
111 Ga0466705_353797 3300042612 Bacteria 2879
112 Ga0466733_000692 3300042659 Bacteria 12300
113 Ga0466733_036471 3300042659 Bacteria 12638
114 Ga0072941_1174360 3300005201 Bacteria 13513
115 Ga0466705_447238 3300042612 Bacteria 2946
116 Ga0466711_438589 3300042615 Unclassified 1490
117 Ga0466723_120151 3300042618 Bacteria 33261
118 Ga0466726_157414 3300042619 Bacteria 8496
119 Ga0466703_112455 3300042636 Bacteria 9603
120 Ga0466703_156534 3300042636 Bacteria 2649
121 Ga0466704_075096 3300042643 Bacteria 2100
122 Ga0466704_148095 3300042643 Bacteria 4848
123 Ga0466708_025774 3300042652 Bacteria 12510
124 Ga0466706_200315 3300042599 Bacteria 2784
125 Ga0456237_0003609 3300041968 Unclassified 2502
126 Ga0466692_174683 3300042591 Unclassified 2998

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_333511 Ga0466707_333511_357_1361 334
2 3300042652 Ga0466708_101658 Ga0466708_101658_297_1382 361
3 3300042619 Ga0466726_315192 Ga0466726_315192_3533_4753 368
4 3300042655 Ga0466727_235906 Ga0466727_235906_757_1989 368
5 3300042609 Ga0466722_129458 Ga0466722_129458_323_1564 372
6 3300042636 Ga0466703_112455 Ga0466703_112455_669_1910 373
7 3300042610 Ga0466698_115857 Ga0466698_115857_154_1290 378
8 3300042615 Ga0466711_047599 Ga0466711_047599_3192_4409 378
9 3300005083 Ga0068305_10185401 Ga0068305_101854012 380
10 3300042659 Ga0466733_036471 Ga0466733_036471_10244_11485 380
11 3300042601 Ga0466707_197531 Ga0466707_197531_1370_2620 381
12 3300042620 Ga0466728_141051 Ga0466728_141051_4300_5523 382
13 3300042624 Ga0466735_053874 Ga0466735_053874_757_1989 382
14 3300042601 Ga0466707_135188 Ga0466707_135188_2590_3819 383
15 3300042620 Ga0466728_019446 Ga0466728_019446_731_1945 383
16 3300042606 Ga0466719_264746 Ga0466719_264746_456_1616 386
17 3300042590 Ga0466690_006502 Ga0466690_006502_2627_3829 388
18 3300042636 Ga0466703_123754 Ga0466703_123754_255_1475 388
19 3300042605 Ga0466716_162491 Ga0466716_162491_56_1300 392
20 3300042615 Ga0466711_438589 Ga0466711_438589_96_1328 392
21 3300042636 Ga0466703_108731 Ga0466703_108731_143_1384 392
22 3300042596 Ga0466696_141945 Ga0466696_141945_2488_3729 393
23 2225789004 2227560451 2228096660 394
24 3300042605 Ga0466716_159181 Ga0466716_159181_1677_2891 394
25 3300042643 Ga0466704_128923 Ga0466704_128923_279_1520 394
26 3300042590 Ga0466690_125787 Ga0466690_125787_1543_2760 395
27 3300042593 Ga0466691_066219 Ga0466691_066219_761_1993 395
28 3300042596 Ga0466696_464269 Ga0466696_464269_1323_2546 395
29 3300042615 Ga0466711_143374 Ga0466711_143374_4153_5379 395
30 3300005200 Ga0072940_1113583 Ga0072940_11135832 396
31 3300042624 Ga0466735_197405 Ga0466735_197405_197_1438 396
32 3300042648 Ga0466709_413906 Ga0466709_413906_168_1400 397
33 3300042659 Ga0466733_000692 Ga0466733_000692_10888_12111 397
34 3300042602 Ga0466713_131141 Ga0466713_131141_4778_6013 398
35 3300042643 Ga0466704_376545 Ga0466704_376545_600_1796 398
36 3300042648 Ga0466709_229995 Ga0466709_229995_5137_6336 399
37 3300042599 Ga0466706_175765 Ga0466706_175765_3193_4395 400
38 3300042601 Ga0466707_421264 Ga0466707_421264_608_1813 401
39 3300042615 Ga0466711_508885 Ga0466711_508885_211_1416 401
40 3300042621 Ga0466729_023152 Ga0466729_023152_2371_3594 402
41 3300042643 Ga0466704_300905 Ga0466704_300905_174_1415 402
42 3300042599 Ga0466706_095663 Ga0466706_095663_75839_77050 403
43 3300042599 Ga0466706_200315 Ga0466706_200315_787_1998 403
44 3300000062 IMNBL1DRAFT_c0031195 IMNBL1DRAFT_00311952 404
45 3300042616 Ga0466715_275902 Ga0466715_275902_492_1706 404
46 3300042621 Ga0466729_239873 Ga0466729_239873_488_1702 404
47 3300042655 Ga0466727_274265 Ga0466727_274265_1181_2395 404
48 3300042659 Ga0466733_104370 Ga0466733_104370_998_2212 404
49 3300042612 Ga0466705_134441 Ga0466705_134441_686_1903 405
50 3300042655 Ga0466727_155234 Ga0466727_155234_471_1688 405
51 3300042655 Ga0466727_170957 Ga0466727_170957_694_1911 405
52 iso_pr_bacteria 2922326829 2922326985 405
53 iso_pr_bacteria 3004677695 3004677930 405
54 3300005071 Ga0068302_10074303 Ga0068302_100743039 406
55 3300042615 Ga0466711_036318 Ga0466711_036318_17862_19082 406
56 3300042615 Ga0466711_071126 Ga0466711_071126_758_1978 406
57 3300042618 Ga0466723_120151 Ga0466723_120151_23474_24694 406
58 3300042618 Ga0466723_226270 Ga0466723_226270_648_1868 406
59 3300042621 Ga0466729_063125 Ga0466729_063125_172_1392 406
60 3300042643 Ga0466704_079855 Ga0466704_079855_1464_2684 406
61 3300010049 Ga0123356_10596089 Ga0123356_105960891 407
62 3300042605 Ga0466716_222953 Ga0466716_222953_572_1795 407
63 3300042619 Ga0466726_197104 Ga0466726_197104_127_1350 407
64 3300042648 Ga0466709_087182 Ga0466709_087182_12061_13284 407
65 3300042652 Ga0466708_220833 Ga0466708_220833_249_1472 407
66 3300042655 Ga0466727_102193 Ga0466727_102193_16993_18216 407
67 3300042656 Ga0466732_043598 Ga0466732_043598_54439_55662 407
68 3300038395 Ga0415639_060692 Ga0415639_060692_2491_3717 408
69 3300042593 Ga0466691_081639 Ga0466691_081639_21327_22553 408
70 3300042596 Ga0466696_206364 Ga0466696_206364_290_1516 408
71 3300042612 Ga0466705_091653 Ga0466705_091653_2284_3510 408
72 3300042612 Ga0466705_447238 Ga0466705_447238_374_1600 408
73 3300042612 Ga0466705_512278 Ga0466705_512278_649_1875 408
74 3300042615 Ga0466711_203198 Ga0466711_203198_11308_12534 408
75 3300042620 Ga0466728_036084 Ga0466728_036084_573_1799 408
76 3300042621 Ga0466729_016304 Ga0466729_016304_2431_3657 408
77 3300042636 Ga0466703_199437 Ga0466703_199437_3072_4298 408
78 3300042643 Ga0466704_258320 Ga0466704_258320_6453_7679 408
79 3300042643 Ga0466704_443177 Ga0466704_443177_567_1793 408
80 3300042643 Ga0466704_619673 Ga0466704_619673_113_1339 408
81 3300042652 Ga0466708_025774 Ga0466708_025774_1249_2475 408
82 3300042659 Ga0466733_144534 Ga0466733_144534_2429_3655 408
83 3300002504 JGI24705J35276_12219288 JGI24705J35276_122192882 409
84 3300010049 Ga0123356_10003262 Ga0123356_1000326219 409
85 3300042593 Ga0466691_003671 Ga0466691_003671_394_1623 409
86 3300010049 Ga0123356_10002936 Ga0123356_100029364 410
87 3300042590 Ga0466690_031683 Ga0466690_031683_2701_3933 410
88 3300042596 Ga0466696_066912 Ga0466696_066912_385_1617 410
89 3300042601 Ga0466707_250571 Ga0466707_250571_330_1562 410
90 3300042605 Ga0466716_032962 Ga0466716_032962_13317_14549 410
91 3300042636 Ga0466703_156534 Ga0466703_156534_949_2181 410
92 3300042648 Ga0466709_405046 Ga0466709_405046_2592_3878 410
93 3300042649 Ga0466724_53887 Ga0466724_53887_36459_37691 410
94 3300041968 Ga0456237_0003609 Ga0456237_0003609_710_1945 411
95 3300042591 Ga0466692_174683 Ga0466692_174683_792_2027 411
96 3300042621 Ga0466729_097238 Ga0466729_097238_214_1449 411
97 3300042593 Ga0466691_028163 Ga0466691_028163_4970_6208 412
98 3300042593 Ga0466691_048607 Ga0466691_048607_746_1984 412
99 3300042594 Ga0466694_221801 Ga0466694_221801_45_1283 412
100 3300042612 Ga0466705_215741 Ga0466705_215741_396_1634 412
101 3300042616 Ga0466715_551893 Ga0466715_551893_256_1494 412
102 3300042606 Ga0466719_260343 Ga0466719_260343_2445_3686 413
103 3300042612 Ga0466705_027962 Ga0466705_027962_459_1700 413
104 3300042618 Ga0466723_166508 Ga0466723_166508_270_1511 413
105 3300042621 Ga0466729_298784 Ga0466729_298784_1251_2492 413
106 3300002504 JGI24705J35276_12218485 JGI24705J35276_122184852 414
107 3300005201 Ga0072941_1174360 Ga0072941_11743609 414
108 3300042593 Ga0466691_018446 Ga0466691_018446_7016_8260 414
109 3300042609 Ga0466722_126114 Ga0466722_126114_9707_10951 414
110 3300042612 Ga0466705_010159 Ga0466705_010159_630_1874 414
111 3300042612 Ga0466705_027418 Ga0466705_027418_8517_9761 414
112 3300042612 Ga0466705_145068 Ga0466705_145068_469_1713 414
113 3300042612 Ga0466705_193544 Ga0466705_193544_736_1980 414
114 3300042620 Ga0466728_181915 Ga0466728_181915_780_2024 414
115 3300042643 Ga0466704_075096 Ga0466704_075096_397_1641 414
116 3300042643 Ga0466704_575626 Ga0466704_575626_441_1685 414
117 3300042652 Ga0466708_107621 Ga0466708_107621_1284_2528 414
118 3300042606 Ga0466719_219253 Ga0466719_219253_4110_5357 415
119 3300042619 Ga0466726_157414 Ga0466726_157414_7006_8253 415
120 3300042655 Ga0466727_044337 Ga0466727_044337_125_1381 418
121 iso_pr_bacteria 2990166910 2990168537 418
122 3300042612 Ga0466705_353797 Ga0466705_353797_1075_2346 423
123 3300042605 Ga0466716_380175 Ga0466716_380175_3905_5182 425
124 3300042615 Ga0466711_248007 Ga0466711_248007_1134_2414 426
125 3300042643 Ga0466704_148095 Ga0466704_148095_2825_4114 429
126 3300042596 Ga0466696_171842 Ga0466696_171842_1173_2477 434
127 2225789004 2227122472 2227515988 440
128 iso_pr_bacteria 8023752828 8023756463 444
129 iso_pr_bacteria 8025666332 8025669187 444
130 iso_pr_bacteria 8069775773 8069779408 444
131 iso_pr_bacteria 8102246966 8102249821 444
132 3300010882 Ga0123354_10045202 Ga0123354_100452024 445
133 3300042636 Ga0466703_199111 Ga0466703_199111_1024_2385 453

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13175 AAA_15 AAA ATPase domain 314 358 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.