Protein Family IF09190
Metagenome
Isolate
133
Members
46
Samples
126
Scaffolds
405.13
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_199111|Ga0466703_199111_1024_2385
- Length
- 453 aa
- Sequence
- MTKQQFVEWAGLNNGKKYVWVKYLYFQIKFVPLQPNVSMIMSKIKIKNFGPIKSGFQGNGGWLEINKVTVFVGNQGSGKSTVAKLISIFTKIEKSLVRGDFEKDWFEVKNRLKSYYLPYHRLEDYLNDNSEIEYIGNKFSITYKNEKLVVNEIQNSAYSLPKIMYVPAERNLLTYIKGAEELKLSSEALQEFSTEYYSAMQEMNGDVILLPINDTEIRYDKRSDELYLKSSDFRIKLRVASSGFQSFVPLYLVSDYLANSVKQQSGKKAAMSSEETVKFQKGLRTIWDNEHLTDIQKRQAISELASAFNKTAFVNIVEEPEQNLFPSSQWQMLQSLLALNNMNIGNKLIMTTHSPYLINYLTIAIKAKQVFDSLSKNKKEVLSSAISNLINLNSCTNADGVSIYEMEEKTGIIKSLPKYNDLIPSDDNFLNNMLADTNNLFAELQEIEEENEN
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.1%
Termitidae
22.2%
Termopsidae
8.9%
Rhinotermitidae
8.9%
Coreidae
8.9%
Unclassified
6.7%
Blattidae
4.4%
Passalidae
4.4%
Curculionidae
2.2%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 14 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 15 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 35 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_010159 | 3300042612 | Bacteria | 2042 |
| 2 | Ga0466705_193544 | 3300042612 | Unclassified | 2120 |
| 3 | JGI24705J35276_12219288 | 3300002504 | Bacteria | 2196 |
| 4 | Ga0466711_036318 | 3300042615 | Bacteria | 24493 |
| 5 | Ga0466711_203198 | 3300042615 | Bacteria | 14642 |
| 6 | Ga0466711_248007 | 3300042615 | Bacteria | 2748 |
| 7 | Ga0466723_166508 | 3300042618 | Bacteria | 1942 |
| 8 | Ga0466726_315192 | 3300042619 | Bacteria | 6957 |
| 9 | Ga0466729_063125 | 3300042621 | Bacteria | 2278 |
| 10 | Ga0123356_10003262 | 3300010049 | Bacteria | 17030 |
| 11 | Ga0466704_376545 | 3300042643 | Unclassified | 1838 |
| 12 | Ga0466709_413906 | 3300042648 | Bacteria | 1431 |
| 13 | Ga0466708_107621 | 3300042652 | Bacteria | 7616 |
| 14 | Ga0466727_155234 | 3300042655 | Bacteria | 2037 |
| 15 | Ga0466707_197531 | 3300042601 | Bacteria | 3179 |
| 16 | Ga0466719_219253 | 3300042606 | Bacteria | 5709 |
| 17 | Ga0466719_264746 | 3300042606 | Bacteria | 1716 |
| 18 | Ga0466698_115857 | 3300042610 | Bacteria | 1304 |
| 19 | Ga0466690_125787 | 3300042590 | Unclassified | 3564 |
| 20 | Ga0466691_048607 | 3300042593 | Bacteria | 2780 |
| 21 | 2227560451 | 2225789004 | Bacteria | 2731 |
| 22 | Ga0466711_047599 | 3300042615 | Bacteria | 5202 |
| 23 | Ga0466711_071126 | 3300042615 | Bacteria | 3021 |
| 24 | Ga0466711_143374 | 3300042615 | Bacteria | 19009 |
| 25 | Ga0466728_036084 | 3300042620 | Bacteria | 3220 |
| 26 | Ga0466728_141051 | 3300042620 | Bacteria | 14388 |
| 27 | Ga0466704_128923 | 3300042643 | Unclassified | 2781 |
| 28 | Ga0466704_300905 | 3300042643 | Bacteria | 2512 |
| 29 | Ga0466704_619673 | 3300042643 | Bacteria | 2318 |
| 30 | Ga0466709_087182 | 3300042648 | Bacteria | 32518 |
| 31 | Ga0466709_229995 | 3300042648 | Unclassified | 7365 |
| 32 | Ga0466709_405046 | 3300042648 | Unclassified | 4224 |
| 33 | Ga0466727_274265 | 3300042655 | Bacteria | 3348 |
| 34 | Ga0466716_380175 | 3300042605 | Bacteria | 6615 |
| 35 | Ga0466690_006502 | 3300042590 | Bacteria | 4922 |
| 36 | Ga0466691_003671 | 3300042593 | Bacteria | 2014 |
| 37 | Ga0466694_221801 | 3300042594 | Bacteria | 1327 |
| 38 | Ga0466705_091653 | 3300042612 | Bacteria | 4650 |
| 39 | Ga0466705_134441 | 3300042612 | Bacteria | 2227 |
| 40 | Ga0068302_10074303 | 3300005071 | Bacteria | 10727 |
| 41 | Ga0466729_016304 | 3300042621 | Bacteria | 11150 |
| 42 | Ga0466729_239873 | 3300042621 | Unclassified | 1944 |
| 43 | Ga0466704_079855 | 3300042643 | Bacteria | 3567 |
| 44 | Ga0466716_032962 | 3300042605 | Bacteria | 44870 |
| 45 | Ga0466722_129458 | 3300042609 | Bacteria | 1805 |
| 46 | Ga0466691_018446 | 3300042593 | Bacteria | 28676 |
| 47 | Ga0466696_066912 | 3300042596 | Bacteria | 3210 |
| 48 | Ga0466696_141945 | 3300042596 | Bacteria | 13688 |
| 49 | Ga0466705_512278 | 3300042612 | Bacteria | 3208 |
| 50 | Ga0466711_508885 | 3300042615 | Bacteria | 1593 |
| 51 | Ga0466729_097238 | 3300042621 | Bacteria | 11917 |
| 52 | Ga0466729_298784 | 3300042621 | Bacteria | 3193 |
| 53 | Ga0466735_197405 | 3300042624 | Unclassified | 1728 |
| 54 | Ga0466704_443177 | 3300042643 | Bacteria | 2388 |
| 55 | Ga0466727_102193 | 3300042655 | Bacteria | 19122 |
| 56 | Ga0466706_095663 | 3300042599 | Bacteria | 79833 |
| 57 | Ga0466707_421264 | 3300042601 | Bacteria | 2607 |
| 58 | Ga0466713_131141 | 3300042602 | Bacteria | 6328 |
| 59 | Ga0466691_028163 | 3300042593 | Bacteria | 8650 |
| 60 | Ga0466691_066219 | 3300042593 | Bacteria | 2306 |
| 61 | Ga0466696_171842 | 3300042596 | Unclassified | 2646 |
| 62 | Ga0466705_027418 | 3300042612 | Unclassified | 15109 |
| 63 | Ga0466733_104370 | 3300042659 | Bacteria | 2375 |
| 64 | Ga0072940_1113583 | 3300005200 | Unclassified | 1783 |
| 65 | Ga0466728_181915 | 3300042620 | Bacteria | 2717 |
| 66 | Ga0466735_053874 | 3300042624 | Bacteria | 2150 |
| 67 | Ga0466703_123754 | 3300042636 | Bacteria | 2095 |
| 68 | Ga0466708_101658 | 3300042652 | Bacteria | 1451 |
| 69 | Ga0466727_044337 | 3300042655 | Bacteria | 1748 |
| 70 | Ga0466707_135188 | 3300042601 | Bacteria | 4322 |
| 71 | Ga0466716_162491 | 3300042605 | Bacteria | 1341 |
| 72 | Ga0466719_260343 | 3300042606 | Bacteria | 3779 |
| 73 | Ga0466691_081639 | 3300042593 | Bacteria | 33689 |
| 74 | 2227122472 | 2225789004 | Bacteria | 9157 |
| 75 | IMNBL1DRAFT_c0031195 | 3300000062 | Unclassified | 1942 |
| 76 | Ga0466715_275902 | 3300042616 | Bacteria | 1887 |
| 77 | Ga0466715_551893 | 3300042616 | Bacteria | 1818 |
| 78 | Ga0466729_023152 | 3300042621 | Bacteria | 5164 |
| 79 | Ga0123356_10596089 | 3300010049 | Bacteria | 1269 |
| 80 | Ga0123354_10045202 | 3300010882 | Bacteria | 6742 |
| 81 | Ga0466703_199437 | 3300042636 | Bacteria | 5347 |
| 82 | Ga0466704_258320 | 3300042643 | Bacteria | 11896 |
| 83 | Ga0466727_170957 | 3300042655 | Bacteria | 2476 |
| 84 | Ga0466727_235906 | 3300042655 | Bacteria | 2187 |
| 85 | Ga0466706_175765 | 3300042599 | Bacteria | 6049 |
| 86 | Ga0466716_159181 | 3300042605 | Bacteria | 5411 |
| 87 | Ga0466722_126114 | 3300042609 | Bacteria | 15006 |
| 88 | Ga0466690_031683 | 3300042590 | Bacteria | 5617 |
| 89 | Ga0466696_206364 | 3300042596 | Bacteria | 2250 |
| 90 | Ga0466696_464269 | 3300042596 | Bacteria | 6058 |
| 91 | Ga0466705_027962 | 3300042612 | Bacteria | 3854 |
| 92 | Ga0466705_145068 | 3300042612 | Bacteria | 3429 |
| 93 | Ga0466705_215741 | 3300042612 | Bacteria | 2081 |
| 94 | Ga0466732_043598 | 3300042656 | Bacteria | 56649 |
| 95 | Ga0466733_144534 | 3300042659 | Bacteria | 4992 |
| 96 | JGI24705J35276_12218485 | 3300002504 | Bacteria | 2147 |
| 97 | Ga0068305_10185401 | 3300005083 | Bacteria | 2267 |
| 98 | Ga0466723_226270 | 3300042618 | Bacteria | 26023 |
| 99 | Ga0466726_197104 | 3300042619 | Bacteria | 6399 |
| 100 | Ga0466728_019446 | 3300042620 | Bacteria | 2301 |
| 101 | Ga0123356_10002936 | 3300010049 | Unclassified | 18046 |
| 102 | Ga0466703_108731 | 3300042636 | Bacteria | 1689 |
| 103 | Ga0466703_199111 | 3300042636 | Bacteria | 2536 |
| 104 | Ga0466704_575626 | 3300042643 | Bacteria | 2166 |
| 105 | Ga0466724_53887 | 3300042649 | Bacteria | 97080 |
| 106 | Ga0466708_220833 | 3300042652 | Bacteria | 2143 |
| 107 | Ga0466707_250571 | 3300042601 | Bacteria | 3862 |
| 108 | Ga0466707_333511 | 3300042601 | Bacteria | 1407 |
| 109 | Ga0466716_222953 | 3300042605 | Bacteria | 3199 |
| 110 | Ga0415639_060692 | 3300038395 | Bacteria | 8444 |
| 111 | Ga0466705_353797 | 3300042612 | Bacteria | 2879 |
| 112 | Ga0466733_000692 | 3300042659 | Bacteria | 12300 |
| 113 | Ga0466733_036471 | 3300042659 | Bacteria | 12638 |
| 114 | Ga0072941_1174360 | 3300005201 | Bacteria | 13513 |
| 115 | Ga0466705_447238 | 3300042612 | Bacteria | 2946 |
| 116 | Ga0466711_438589 | 3300042615 | Unclassified | 1490 |
| 117 | Ga0466723_120151 | 3300042618 | Bacteria | 33261 |
| 118 | Ga0466726_157414 | 3300042619 | Bacteria | 8496 |
| 119 | Ga0466703_112455 | 3300042636 | Bacteria | 9603 |
| 120 | Ga0466703_156534 | 3300042636 | Bacteria | 2649 |
| 121 | Ga0466704_075096 | 3300042643 | Bacteria | 2100 |
| 122 | Ga0466704_148095 | 3300042643 | Bacteria | 4848 |
| 123 | Ga0466708_025774 | 3300042652 | Bacteria | 12510 |
| 124 | Ga0466706_200315 | 3300042599 | Bacteria | 2784 |
| 125 | Ga0456237_0003609 | 3300041968 | Unclassified | 2502 |
| 126 | Ga0466692_174683 | 3300042591 | Unclassified | 2998 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_333511 | Ga0466707_333511_357_1361 | 334 |
| 2 | 3300042652 | Ga0466708_101658 | Ga0466708_101658_297_1382 | 361 |
| 3 | 3300042619 | Ga0466726_315192 | Ga0466726_315192_3533_4753 | 368 |
| 4 | 3300042655 | Ga0466727_235906 | Ga0466727_235906_757_1989 | 368 |
| 5 | 3300042609 | Ga0466722_129458 | Ga0466722_129458_323_1564 | 372 |
| 6 | 3300042636 | Ga0466703_112455 | Ga0466703_112455_669_1910 | 373 |
| 7 | 3300042610 | Ga0466698_115857 | Ga0466698_115857_154_1290 | 378 |
| 8 | 3300042615 | Ga0466711_047599 | Ga0466711_047599_3192_4409 | 378 |
| 9 | 3300005083 | Ga0068305_10185401 | Ga0068305_101854012 | 380 |
| 10 | 3300042659 | Ga0466733_036471 | Ga0466733_036471_10244_11485 | 380 |
| 11 | 3300042601 | Ga0466707_197531 | Ga0466707_197531_1370_2620 | 381 |
| 12 | 3300042620 | Ga0466728_141051 | Ga0466728_141051_4300_5523 | 382 |
| 13 | 3300042624 | Ga0466735_053874 | Ga0466735_053874_757_1989 | 382 |
| 14 | 3300042601 | Ga0466707_135188 | Ga0466707_135188_2590_3819 | 383 |
| 15 | 3300042620 | Ga0466728_019446 | Ga0466728_019446_731_1945 | 383 |
| 16 | 3300042606 | Ga0466719_264746 | Ga0466719_264746_456_1616 | 386 |
| 17 | 3300042590 | Ga0466690_006502 | Ga0466690_006502_2627_3829 | 388 |
| 18 | 3300042636 | Ga0466703_123754 | Ga0466703_123754_255_1475 | 388 |
| 19 | 3300042605 | Ga0466716_162491 | Ga0466716_162491_56_1300 | 392 |
| 20 | 3300042615 | Ga0466711_438589 | Ga0466711_438589_96_1328 | 392 |
| 21 | 3300042636 | Ga0466703_108731 | Ga0466703_108731_143_1384 | 392 |
| 22 | 3300042596 | Ga0466696_141945 | Ga0466696_141945_2488_3729 | 393 |
| 23 | 2225789004 | 2227560451 | 2228096660 | 394 |
| 24 | 3300042605 | Ga0466716_159181 | Ga0466716_159181_1677_2891 | 394 |
| 25 | 3300042643 | Ga0466704_128923 | Ga0466704_128923_279_1520 | 394 |
| 26 | 3300042590 | Ga0466690_125787 | Ga0466690_125787_1543_2760 | 395 |
| 27 | 3300042593 | Ga0466691_066219 | Ga0466691_066219_761_1993 | 395 |
| 28 | 3300042596 | Ga0466696_464269 | Ga0466696_464269_1323_2546 | 395 |
| 29 | 3300042615 | Ga0466711_143374 | Ga0466711_143374_4153_5379 | 395 |
| 30 | 3300005200 | Ga0072940_1113583 | Ga0072940_11135832 | 396 |
| 31 | 3300042624 | Ga0466735_197405 | Ga0466735_197405_197_1438 | 396 |
| 32 | 3300042648 | Ga0466709_413906 | Ga0466709_413906_168_1400 | 397 |
| 33 | 3300042659 | Ga0466733_000692 | Ga0466733_000692_10888_12111 | 397 |
| 34 | 3300042602 | Ga0466713_131141 | Ga0466713_131141_4778_6013 | 398 |
| 35 | 3300042643 | Ga0466704_376545 | Ga0466704_376545_600_1796 | 398 |
| 36 | 3300042648 | Ga0466709_229995 | Ga0466709_229995_5137_6336 | 399 |
| 37 | 3300042599 | Ga0466706_175765 | Ga0466706_175765_3193_4395 | 400 |
| 38 | 3300042601 | Ga0466707_421264 | Ga0466707_421264_608_1813 | 401 |
| 39 | 3300042615 | Ga0466711_508885 | Ga0466711_508885_211_1416 | 401 |
| 40 | 3300042621 | Ga0466729_023152 | Ga0466729_023152_2371_3594 | 402 |
| 41 | 3300042643 | Ga0466704_300905 | Ga0466704_300905_174_1415 | 402 |
| 42 | 3300042599 | Ga0466706_095663 | Ga0466706_095663_75839_77050 | 403 |
| 43 | 3300042599 | Ga0466706_200315 | Ga0466706_200315_787_1998 | 403 |
| 44 | 3300000062 | IMNBL1DRAFT_c0031195 | IMNBL1DRAFT_00311952 | 404 |
| 45 | 3300042616 | Ga0466715_275902 | Ga0466715_275902_492_1706 | 404 |
| 46 | 3300042621 | Ga0466729_239873 | Ga0466729_239873_488_1702 | 404 |
| 47 | 3300042655 | Ga0466727_274265 | Ga0466727_274265_1181_2395 | 404 |
| 48 | 3300042659 | Ga0466733_104370 | Ga0466733_104370_998_2212 | 404 |
| 49 | 3300042612 | Ga0466705_134441 | Ga0466705_134441_686_1903 | 405 |
| 50 | 3300042655 | Ga0466727_155234 | Ga0466727_155234_471_1688 | 405 |
| 51 | 3300042655 | Ga0466727_170957 | Ga0466727_170957_694_1911 | 405 |
| 52 | iso_pr_bacteria | 2922326829 | 2922326985 | 405 |
| 53 | iso_pr_bacteria | 3004677695 | 3004677930 | 405 |
| 54 | 3300005071 | Ga0068302_10074303 | Ga0068302_100743039 | 406 |
| 55 | 3300042615 | Ga0466711_036318 | Ga0466711_036318_17862_19082 | 406 |
| 56 | 3300042615 | Ga0466711_071126 | Ga0466711_071126_758_1978 | 406 |
| 57 | 3300042618 | Ga0466723_120151 | Ga0466723_120151_23474_24694 | 406 |
| 58 | 3300042618 | Ga0466723_226270 | Ga0466723_226270_648_1868 | 406 |
| 59 | 3300042621 | Ga0466729_063125 | Ga0466729_063125_172_1392 | 406 |
| 60 | 3300042643 | Ga0466704_079855 | Ga0466704_079855_1464_2684 | 406 |
| 61 | 3300010049 | Ga0123356_10596089 | Ga0123356_105960891 | 407 |
| 62 | 3300042605 | Ga0466716_222953 | Ga0466716_222953_572_1795 | 407 |
| 63 | 3300042619 | Ga0466726_197104 | Ga0466726_197104_127_1350 | 407 |
| 64 | 3300042648 | Ga0466709_087182 | Ga0466709_087182_12061_13284 | 407 |
| 65 | 3300042652 | Ga0466708_220833 | Ga0466708_220833_249_1472 | 407 |
| 66 | 3300042655 | Ga0466727_102193 | Ga0466727_102193_16993_18216 | 407 |
| 67 | 3300042656 | Ga0466732_043598 | Ga0466732_043598_54439_55662 | 407 |
| 68 | 3300038395 | Ga0415639_060692 | Ga0415639_060692_2491_3717 | 408 |
| 69 | 3300042593 | Ga0466691_081639 | Ga0466691_081639_21327_22553 | 408 |
| 70 | 3300042596 | Ga0466696_206364 | Ga0466696_206364_290_1516 | 408 |
| 71 | 3300042612 | Ga0466705_091653 | Ga0466705_091653_2284_3510 | 408 |
| 72 | 3300042612 | Ga0466705_447238 | Ga0466705_447238_374_1600 | 408 |
| 73 | 3300042612 | Ga0466705_512278 | Ga0466705_512278_649_1875 | 408 |
| 74 | 3300042615 | Ga0466711_203198 | Ga0466711_203198_11308_12534 | 408 |
| 75 | 3300042620 | Ga0466728_036084 | Ga0466728_036084_573_1799 | 408 |
| 76 | 3300042621 | Ga0466729_016304 | Ga0466729_016304_2431_3657 | 408 |
| 77 | 3300042636 | Ga0466703_199437 | Ga0466703_199437_3072_4298 | 408 |
| 78 | 3300042643 | Ga0466704_258320 | Ga0466704_258320_6453_7679 | 408 |
| 79 | 3300042643 | Ga0466704_443177 | Ga0466704_443177_567_1793 | 408 |
| 80 | 3300042643 | Ga0466704_619673 | Ga0466704_619673_113_1339 | 408 |
| 81 | 3300042652 | Ga0466708_025774 | Ga0466708_025774_1249_2475 | 408 |
| 82 | 3300042659 | Ga0466733_144534 | Ga0466733_144534_2429_3655 | 408 |
| 83 | 3300002504 | JGI24705J35276_12219288 | JGI24705J35276_122192882 | 409 |
| 84 | 3300010049 | Ga0123356_10003262 | Ga0123356_1000326219 | 409 |
| 85 | 3300042593 | Ga0466691_003671 | Ga0466691_003671_394_1623 | 409 |
| 86 | 3300010049 | Ga0123356_10002936 | Ga0123356_100029364 | 410 |
| 87 | 3300042590 | Ga0466690_031683 | Ga0466690_031683_2701_3933 | 410 |
| 88 | 3300042596 | Ga0466696_066912 | Ga0466696_066912_385_1617 | 410 |
| 89 | 3300042601 | Ga0466707_250571 | Ga0466707_250571_330_1562 | 410 |
| 90 | 3300042605 | Ga0466716_032962 | Ga0466716_032962_13317_14549 | 410 |
| 91 | 3300042636 | Ga0466703_156534 | Ga0466703_156534_949_2181 | 410 |
| 92 | 3300042648 | Ga0466709_405046 | Ga0466709_405046_2592_3878 | 410 |
| 93 | 3300042649 | Ga0466724_53887 | Ga0466724_53887_36459_37691 | 410 |
| 94 | 3300041968 | Ga0456237_0003609 | Ga0456237_0003609_710_1945 | 411 |
| 95 | 3300042591 | Ga0466692_174683 | Ga0466692_174683_792_2027 | 411 |
| 96 | 3300042621 | Ga0466729_097238 | Ga0466729_097238_214_1449 | 411 |
| 97 | 3300042593 | Ga0466691_028163 | Ga0466691_028163_4970_6208 | 412 |
| 98 | 3300042593 | Ga0466691_048607 | Ga0466691_048607_746_1984 | 412 |
| 99 | 3300042594 | Ga0466694_221801 | Ga0466694_221801_45_1283 | 412 |
| 100 | 3300042612 | Ga0466705_215741 | Ga0466705_215741_396_1634 | 412 |
| 101 | 3300042616 | Ga0466715_551893 | Ga0466715_551893_256_1494 | 412 |
| 102 | 3300042606 | Ga0466719_260343 | Ga0466719_260343_2445_3686 | 413 |
| 103 | 3300042612 | Ga0466705_027962 | Ga0466705_027962_459_1700 | 413 |
| 104 | 3300042618 | Ga0466723_166508 | Ga0466723_166508_270_1511 | 413 |
| 105 | 3300042621 | Ga0466729_298784 | Ga0466729_298784_1251_2492 | 413 |
| 106 | 3300002504 | JGI24705J35276_12218485 | JGI24705J35276_122184852 | 414 |
| 107 | 3300005201 | Ga0072941_1174360 | Ga0072941_11743609 | 414 |
| 108 | 3300042593 | Ga0466691_018446 | Ga0466691_018446_7016_8260 | 414 |
| 109 | 3300042609 | Ga0466722_126114 | Ga0466722_126114_9707_10951 | 414 |
| 110 | 3300042612 | Ga0466705_010159 | Ga0466705_010159_630_1874 | 414 |
| 111 | 3300042612 | Ga0466705_027418 | Ga0466705_027418_8517_9761 | 414 |
| 112 | 3300042612 | Ga0466705_145068 | Ga0466705_145068_469_1713 | 414 |
| 113 | 3300042612 | Ga0466705_193544 | Ga0466705_193544_736_1980 | 414 |
| 114 | 3300042620 | Ga0466728_181915 | Ga0466728_181915_780_2024 | 414 |
| 115 | 3300042643 | Ga0466704_075096 | Ga0466704_075096_397_1641 | 414 |
| 116 | 3300042643 | Ga0466704_575626 | Ga0466704_575626_441_1685 | 414 |
| 117 | 3300042652 | Ga0466708_107621 | Ga0466708_107621_1284_2528 | 414 |
| 118 | 3300042606 | Ga0466719_219253 | Ga0466719_219253_4110_5357 | 415 |
| 119 | 3300042619 | Ga0466726_157414 | Ga0466726_157414_7006_8253 | 415 |
| 120 | 3300042655 | Ga0466727_044337 | Ga0466727_044337_125_1381 | 418 |
| 121 | iso_pr_bacteria | 2990166910 | 2990168537 | 418 |
| 122 | 3300042612 | Ga0466705_353797 | Ga0466705_353797_1075_2346 | 423 |
| 123 | 3300042605 | Ga0466716_380175 | Ga0466716_380175_3905_5182 | 425 |
| 124 | 3300042615 | Ga0466711_248007 | Ga0466711_248007_1134_2414 | 426 |
| 125 | 3300042643 | Ga0466704_148095 | Ga0466704_148095_2825_4114 | 429 |
| 126 | 3300042596 | Ga0466696_171842 | Ga0466696_171842_1173_2477 | 434 |
| 127 | 2225789004 | 2227122472 | 2227515988 | 440 |
| 128 | iso_pr_bacteria | 8023752828 | 8023756463 | 444 |
| 129 | iso_pr_bacteria | 8025666332 | 8025669187 | 444 |
| 130 | iso_pr_bacteria | 8069775773 | 8069779408 | 444 |
| 131 | iso_pr_bacteria | 8102246966 | 8102249821 | 444 |
| 132 | 3300010882 | Ga0123354_10045202 | Ga0123354_100452024 | 445 |
| 133 | 3300042636 | Ga0466703_199111 | Ga0466703_199111_1024_2385 | 453 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13175 | AAA_15 | AAA ATPase domain | 314 | 358 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.