Protein Family IF09176

Metagenome Isolate
211 Members
85 Samples
194 Scaffolds
151.63 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_177584|Ga0466703_177584_2240_2722
Length
160 aa
Sequence
VNTLSYKTISANKATVNKEWVVVDATGQHLGRISSKVAKLLRGKYKTNYTPHVDCGDNVIIINADKVILTGKKWTDRIYYTYSGYPGGQKTLTPAVLKAKGDNAKLKSMGKDRLFHKVIKGMLPKNKLGDKLIGNLYVYGGSEHKQEAQQPKSIDINSLK

📊 Sample Types

Isolate 8.1%
Metagenome 91.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.1%
Kalotermitidae 17.1%
Unclassified 13.4%
Formicidae 9.8%
Drosophilidae 4.9%
Blattidae 3.7%
Rhinotermitidae 3.7%
Termopsidae 3.7%
Elmidae 2.4%
Passalidae 2.4%
Harpacticidae 1.2%
Hodotermitidae 1.2%
Daphniidae 1.2%
Cambaridae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 183
Eukaryota 0
Viruses 0
Unclassified 28

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
2 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
3 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
8 2021593000 Sample 264 Metagenome Harpacticidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
11 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
18 2882250448 Bizionia sp. APA-3 Isolate
19 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
23 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
26 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
27 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
39 2904728850 Flavobacterium sp. xlx-214 Isolate
40 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
41 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
48 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
56 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
59 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
60 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
61 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
62 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
63 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
64 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
65 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
66 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
67 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
68 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
69 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
72 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
74 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
75 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
76 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
77 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
78 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
79 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
80 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
81 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
82 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
83 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
84 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
85 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10220445 3300009784 Unclassified 2106
2 Ga0123356_10002950 3300010049 Bacteria 17981
3 Ga0123356_10509218 3300010049 Bacteria 1361
4 Ga0123354_10329179 3300010882 Bacteria 1396
5 Ga0466710_219819 3300042613 Bacteria 1901
6 Ga0466710_407187 3300042613 Bacteria 1450
7 Ga0466711_334516 3300042615 Bacteria 25865
8 Ga0466726_448473 3300042619 Bacteria 4182
9 Ga0466728_410479 3300042620 Bacteria 1585
10 Ga0466701_065848 3300042598 Bacteria 2475
11 Ga0466713_049326 3300042602 Bacteria 5587
12 Ga0466713_107493 3300042602 Bacteria 10837
13 Ga0466713_154447 3300042602 Bacteria 6036
14 Ga0415639_107228 3300038395 Bacteria 1426
15 Ga0466695_214855 3300042595 Unclassified 3618
16 IMNBL1DRAFT_c0000101 3300000062 Bacteria 74878
17 IMNBL1DRAFT_c0020524 3300000062 Bacteria 2673
18 Ga0074188_1007577 3300005318 Unclassified 1077
19 Ga0105553_1033704 3300007767 Unclassified 2826
20 Ga0466703_047475 3300042636 Bacteria 4978
21 Ga0466697_220463 3300042611 Bacteria 1043
22 Ga0466733_108422 3300042659 Bacteria 6239
23 Ga0466733_114022 3300042659 Bacteria 2502
24 Ga0466733_114930 3300042659 Bacteria 2163
25 Ga0466733_135976 3300042659 Bacteria 1228
26 Ga0123353_10309181 3300010167 Bacteria 2407
27 Ga0123354_10099996 3300010882 Bacteria 3929
28 Ga0466711_045977 3300042615 Bacteria 15196
29 Ga0466718_016586 3300042617 Unclassified 1118
30 Ga0466726_082211 3300042619 Bacteria 1799
31 Ga0466728_098412 3300042620 Bacteria 11114
32 Ga0466728_266497 3300042620 Bacteria 6939
33 Ga0466706_080990 3300042599 Bacteria 1068
34 Ga0466707_317458 3300042601 Bacteria 5841
35 Ga0466716_130562 3300042605 Bacteria 9764
36 Ga0466722_026759 3300042609 Bacteria 6658
37 Ga0466656_323149 3300042550 Bacteria 1299
38 Ga0466692_135488 3300042591 Bacteria 6143
39 Ga0466696_073791 3300042596 Bacteria 5300
40 Ga0466699_078590 3300042597 Bacteria 1343
41 JGI24702J35022_10000550 3300002462 Bacteria 22684
42 Ga0068305_10134089 3300005083 Bacteria 11374
43 Ga0466729_314350 3300042621 Bacteria 3354
44 Ga0466735_030140 3300042624 Bacteria 6167
45 Ga0466704_304044 3300042643 Bacteria 3260
46 Ga0466709_332846 3300042648 Unclassified 3700
47 Ga0466708_034215 3300042652 Unclassified 4234
48 Ga0466725_088001 3300042654 Bacteria 2782
49 Ga0466727_319003 3300042655 Bacteria 50861
50 Ga0123356_11061270 3300010049 Bacteria 979
51 Ga0466715_317845 3300042616 Unclassified 6552
52 Ga0466723_018026 3300042618 Bacteria 7658
53 Ga0466701_068702 3300042598 Bacteria 3861
54 Ga0466700_020768 3300042600 Unclassified 1386
55 Ga0466700_216390 3300042600 Bacteria 24849
56 Ga0466707_138176 3300042601 Bacteria 1922
57 Ga0466707_146418 3300042601 Bacteria 49406
58 Ga0466716_186862 3300042605 Bacteria 1248
59 Ga0466722_258238 3300042609 Bacteria 2255
60 Ga0466656_183241 3300042550 Bacteria 12454
61 Ga0466657_053016 3300042582 Unclassified 8757
62 Ga0466690_069865 3300042590 Bacteria 123255
63 Ga0466692_092133 3300042591 Bacteria 23837
64 Ga0466696_156685 3300042596 Bacteria 1497
65 2227487151 2225789004 Unclassified 4209
66 IMNBL1DRAFT_c0000765 3300000062 Bacteria 25410
67 IMNBL1DRAFT_c0013669 3300000062 Bacteria 3625
68 JGI24702J35022_10000785 3300002462 Bacteria 19698
69 JGI24702J35022_10062639 3300002462 Bacteria 1992
70 JGI24702J35022_10216698 3300002462 Bacteria 1101
71 Ga0068305_10189950 3300005083 Bacteria 2432
72 Ga0072941_1381611 3300005201 Bacteria 1339
73 Ga0102734_1000285 3300007129 Bacteria 15657
74 Ga0102737_1000001 3300007142 Bacteria 193099
75 Ga0466708_176752 3300042652 Bacteria 26441
76 Ga0123355_10000179 3300009826 Bacteria 78580
77 Ga0123355_12177017 3300009826 Unclassified 507
78 Ga0123354_10855958 3300010882 Bacteria 603
79 Ga0466710_095685 3300042613 Bacteria 2125
80 Ga0466715_636818 3300042616 Bacteria 23439
81 Ga0466726_051140 3300042619 Bacteria 13651
82 Ga0466728_096152 3300042620 Bacteria 2966
83 Ga0466729_141989 3300042621 Bacteria 8164
84 Ga0466707_115106 3300042601 Bacteria 8408
85 Ga0466707_289261 3300042601 Bacteria 32485
86 Ga0466713_118879 3300042602 Bacteria 8180
87 Ga0466716_344194 3300042605 Bacteria 3447
88 Ga0466719_035929 3300042606 Bacteria 3812
89 Ga0466656_237653 3300042550 Bacteria 1988
90 Ga0466657_073389 3300042582 Bacteria 7915
91 Ga0466657_197510 3300042582 Bacteria 8307
92 Ga0466691_034684 3300042593 Bacteria 20073
93 Ga0466694_205561 3300042594 Unclassified 1355
94 Ga0466696_045014 3300042596 Bacteria 4920
95 Ga0466696_111737 3300042596 Bacteria 11009
96 Ga0466696_456494 3300042596 Bacteria 4266
97 Ga0466699_088599 3300042597 Bacteria 2989
98 2227080791 2225789004 Bacteria 41979
99 JGI24698J34947_10193991 3300002449 Unclassified 801
100 JGI24695J34938_10038248 3300002450 Bacteria 2174
101 Ga0102735_1001952 3300007080 Bacteria 3302
102 Ga0466703_351907 3300042636 Bacteria 1020
103 Ga0466709_106774 3300042648 Bacteria 3312
104 Ga0466709_114487 3300042648 Bacteria 52942
105 Ga0466708_001260 3300042652 Bacteria 10233
106 Ga0123356_10377686 3300010049 Bacteria 1549
107 Ga0466715_083168 3300042616 Bacteria 8469
108 Ga0466723_045772 3300042618 Bacteria 6078
109 Ga0466723_356525 3300042618 Bacteria 1333
110 Ga0466728_133538 3300042620 Bacteria 7196
111 Ga0466719_137333 3300042606 Bacteria 11689
112 Ga0466719_166855 3300042606 Bacteria 2934
113 Ga0466693_236987 3300042592 Unclassified 1815
114 Ga0466696_219440 3300042596 Bacteria 17310
115 IMNBL1DRAFT_c0001620 3300000062 Bacteria 16684
116 JGI24705J35276_12103991 3300002504 Unclassified 1025
117 Ga0466735_207810 3300042624 Bacteria 1017
118 Ga0466703_177584 3300042636 Bacteria 3385
119 Ga0466704_060121 3300042643 Bacteria 4943
120 Ga0466727_160046 3300042655 Bacteria 19595
121 Ga0466733_081769 3300042659 Bacteria 11220
122 Ga0123357_10086008 3300009784 Unclassified 4115
123 Ga0123354_10335293 3300010882 Unclassified 1372
124 Ga0466726_030060 3300042619 Bacteria 20392
125 Ga0466729_061452 3300042621 Bacteria 5987
126 Ga0466700_022109 3300042600 Bacteria 1867
127 Ga0466707_378517 3300042601 Bacteria 4550
128 Ga0466713_149519 3300042602 Bacteria 4597
129 Ga0466719_514856 3300042606 Unclassified 1729
130 Ga0466722_115766 3300042609 Bacteria 1166
131 Ga0466690_092486 3300042590 Bacteria 13767
132 Ga0466690_193807 3300042590 Bacteria 7726
133 Ga0466692_203922 3300042591 Bacteria 2019
134 Ga0466691_037573 3300042593 Bacteria 71526
135 Ga0466694_206885 3300042594 Bacteria 1463
136 Ga0466696_483911 3300042596 Bacteria 15522
137 IMNBL1DRAFT_c0000621 3300000062 Bacteria 28351
138 JGI24702J35022_10006073 3300002462 Bacteria 7014
139 CVPL010W_10000573 3300002931 Bacteria 40037
140 Ga0103265_1004787 3300007068 Unclassified 1907
141 Ga0104048_1003309 3300007143 Bacteria 6807
142 Ga0466735_015791 3300042624 Bacteria 10780
143 Ga0466703_096275 3300042636 Bacteria 3608
144 Ga0466704_307328 3300042643 Bacteria 4005
145 Ga0466704_484286 3300042643 Bacteria 8651
146 Ga0466704_485915 3300042643 Bacteria 1022
147 Ga0466727_135560 3300042655 Bacteria 5480
148 Ga0466697_129296 3300042611 Bacteria 1315
149 Ga0466705_172168 3300042612 Bacteria 2142
150 Ga0466712_069580 3300042614 Bacteria 2626
151 Ga0466715_405704 3300042616 Bacteria 5966
152 Ga0466723_037691 3300042618 Bacteria 10554
153 Ga0466728_479488 3300042620 Bacteria 11367
154 Ga0466707_260608 3300042601 Bacteria 6090
155 Ga0466713_001234 3300042602 Bacteria 9209
156 Ga0466714_004537 3300042603 Bacteria 3516
157 Ga0466722_023951 3300042609 Bacteria 6167
158 Ga0466698_085231 3300042610 Bacteria 1743
159 Ga0466698_341279 3300042610 Bacteria 1664
160 Ga0466697_024455 3300042611 Unclassified 5762
161 Ga0466692_115729 3300042591 Bacteria 3402
162 Ga0466699_091643 3300042597 Bacteria 1063
163 JGI24702J35022_10000589 3300002462 Bacteria 22050
164 JGI24702J35022_10526690 3300002462 Unclassified 727
165 Ga0104048_1169343 3300007143 Bacteria 2158
166 Ga0104040_1096349 3300007149 Bacteria 635
167 Ga0103267_1006592 3300007190 Bacteria 3324
168 Ga0103268_1000577 3300007192 Unclassified 15436
169 Ga0466735_051411 3300042624 Bacteria 2475
170 Ga0466704_377212 3300042643 Bacteria 23470
171 Ga0466724_02020 3300042649 Bacteria 1241
172 Ga0466727_258633 3300042655 Bacteria 11671
173 Ga0466705_105693 3300042612 Bacteria 24317
174 Ga0466732_307698 3300042656 Bacteria 1094
175 Ga0123355_10008077 3300009826 Bacteria 15876
176 Ga0123356_10464577 3300010049 Bacteria 1416
177 Ga0123353_10000028 3300010167 Bacteria 164820
178 Ga0123353_11317785 3300010167 Unclassified 936
179 Ga0466711_155472 3300042615 Bacteria 4110
180 Ga0466715_138910 3300042616 Unclassified 6366
181 Ga0466726_264348 3300042619 Bacteria 7865
182 Ga0466707_246431 3300042601 Bacteria 1530
183 Ga0466716_103379 3300042605 Bacteria 5411
184 Ga0466719_548966 3300042606 Bacteria 6040
185 Ga0466722_132989 3300042609 Bacteria 9324
186 Ga0466691_061938 3300042593 Unclassified 3876
187 Ga0466691_133713 3300042593 Unclassified 4364
188 TM1208_contig33542 2021593000 Bacteria 724
189 2227303035 2225789004 Bacteria 6582
190 IMNBL1DRAFT_c0002011 3300000062 Bacteria 14570
191 IMNBL1DRAFT_c0003618 3300000062 Bacteria 9785
192 Ga0102739_1000003 3300007095 Bacteria 77722
193 Ga0466703_215720 3300042636 Bacteria 4224
194 Ga0466703_427727 3300042636 Unclassified 2959

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10855958 Ga0123354_108559582 140
2 3300000062 IMNBL1DRAFT_c0002011 IMNBL1DRAFT_00020113 146
3 2225789004 2227080791 2227454112 150
4 3300042593 Ga0466691_061938 Ga0466691_061938_26_478 150
5 3300042593 Ga0466691_133713 Ga0466691_133713_168_620 150
6 3300042594 Ga0466694_205561 Ga0466694_205561_588_1040 150
7 3300042594 Ga0466694_206885 Ga0466694_206885_68_520 150
8 3300042596 Ga0466696_111737 Ga0466696_111737_7538_7990 150
9 3300042596 Ga0466696_483911 Ga0466696_483911_6006_6458 150
10 3300042598 Ga0466701_065848 Ga0466701_065848_258_710 150
11 3300042605 Ga0466716_344194 Ga0466716_344194_318_770 150
12 3300042606 Ga0466719_166855 Ga0466719_166855_2395_2847 150
13 3300042606 Ga0466719_514856 Ga0466719_514856_88_540 150
14 3300042609 Ga0466722_258238 Ga0466722_258238_669_1121 150
15 3300042611 Ga0466697_024455 Ga0466697_024455_780_1232 150
16 3300042611 Ga0466697_129296 Ga0466697_129296_168_620 150
17 3300042613 Ga0466710_219819 Ga0466710_219819_612_1064 150
18 3300042614 Ga0466712_069580 Ga0466712_069580_232_684 150
19 3300042616 Ga0466715_317845 Ga0466715_317845_5029_5481 150
20 3300042617 Ga0466718_016586 Ga0466718_016586_328_780 150
21 3300042618 Ga0466723_037691 Ga0466723_037691_3723_4175 150
22 3300042618 Ga0466723_045772 Ga0466723_045772_823_1275 150
23 3300042619 Ga0466726_082211 Ga0466726_082211_698_1150 150
24 3300042620 Ga0466728_098412 Ga0466728_098412_7839_8291 150
25 3300042620 Ga0466728_133538 Ga0466728_133538_4208_4660 150
26 3300042620 Ga0466728_479488 Ga0466728_479488_6584_7036 150
27 3300042636 Ga0466703_047475 Ga0466703_047475_3662_4114 150
28 3300042643 Ga0466704_307328 Ga0466704_307328_2473_2925 150
29 3300042648 Ga0466709_106774 Ga0466709_106774_2650_3102 150
30 3300042652 Ga0466708_001260 Ga0466708_001260_7182_7634 150
31 3300042652 Ga0466708_034215 Ga0466708_034215_1583_2035 150
32 3300042654 Ga0466725_088001 Ga0466725_088001_1573_2025 150
33 3300042655 Ga0466727_160046 Ga0466727_160046_15046_15498 150
34 3300042656 Ga0466732_307698 Ga0466732_307698_370_822 150
35 iso_pr_bacteria 2820740053 2820741521 150
36 iso_pr_bacteria 2820772500 2820772925 150
37 iso_pr_bacteria 2820781750 2820782157 150
38 2021593000 TM1208_contig33542 TM1208A_99360 151
39 2225789004 2227303035 2227753447 151
40 2225789004 2227487151 2227954681 151
41 3300000062 IMNBL1DRAFT_c0000765 IMNBL1DRAFT_00007657 151
42 3300000062 IMNBL1DRAFT_c0020524 IMNBL1DRAFT_00205243 151
43 3300002449 JGI24698J34947_10193991 JGI24698J34947_101939912 151
44 3300002462 JGI24702J35022_10000589 JGI24702J35022_1000058911 151
45 3300002462 JGI24702J35022_10006073 JGI24702J35022_100060736 151
46 3300005201 Ga0072941_1381611 Ga0072941_13816111 151
47 3300010049 Ga0123356_10002950 Ga0123356_100029503 151
48 3300010049 Ga0123356_10464577 Ga0123356_104645772 151
49 3300038395 Ga0415639_107228 Ga0415639_107228_525_980 151
50 3300042550 Ga0466656_183241 Ga0466656_183241_4728_5183 151
51 3300042550 Ga0466656_237653 Ga0466656_237653_810_1265 151
52 3300042550 Ga0466656_323149 Ga0466656_323149_458_913 151
53 3300042582 Ga0466657_053016 Ga0466657_053016_1861_2316 151
54 3300042582 Ga0466657_073389 Ga0466657_073389_4276_4731 151
55 3300042582 Ga0466657_197510 Ga0466657_197510_2667_3122 151
56 3300042590 Ga0466690_069865 Ga0466690_069865_108109_108564 151
57 3300042590 Ga0466690_193807 Ga0466690_193807_4215_4670 151
58 3300042591 Ga0466692_092133 Ga0466692_092133_16274_16729 151
59 3300042591 Ga0466692_115729 Ga0466692_115729_306_761 151
60 3300042591 Ga0466692_135488 Ga0466692_135488_1874_2329 151
61 3300042591 Ga0466692_203922 Ga0466692_203922_1389_1844 151
62 3300042592 Ga0466693_236987 Ga0466693_236987_1269_1724 151
63 3300042593 Ga0466691_034684 Ga0466691_034684_10867_11322 151
64 3300042593 Ga0466691_037573 Ga0466691_037573_3148_3603 151
65 3300042595 Ga0466695_214855 Ga0466695_214855_1963_2418 151
66 3300042596 Ga0466696_045014 Ga0466696_045014_1220_1675 151
67 3300042596 Ga0466696_073791 Ga0466696_073791_965_1420 151
68 3300042596 Ga0466696_156685 Ga0466696_156685_217_672 151
69 3300042596 Ga0466696_219440 Ga0466696_219440_10951_11406 151
70 3300042596 Ga0466696_456494 Ga0466696_456494_2751_3206 151
71 3300042597 Ga0466699_078590 Ga0466699_078590_476_931 151
72 3300042597 Ga0466699_088599 Ga0466699_088599_2202_2657 151
73 3300042598 Ga0466701_068702 Ga0466701_068702_2458_2913 151
74 3300042599 Ga0466706_080990 Ga0466706_080990_400_855 151
75 3300042600 Ga0466700_020768 Ga0466700_020768_489_944 151
76 3300042600 Ga0466700_022109 Ga0466700_022109_489_944 151
77 3300042600 Ga0466700_216390 Ga0466700_216390_14570_15025 151
78 3300042601 Ga0466707_115106 Ga0466707_115106_877_1332 151
79 3300042601 Ga0466707_138176 Ga0466707_138176_1036_1491 151
80 3300042601 Ga0466707_146418 Ga0466707_146418_29071_29526 151
81 3300042601 Ga0466707_246431 Ga0466707_246431_65_520 151
82 3300042601 Ga0466707_260608 Ga0466707_260608_339_794 151
83 3300042601 Ga0466707_289261 Ga0466707_289261_20540_20995 151
84 3300042601 Ga0466707_317458 Ga0466707_317458_387_842 151
85 3300042601 Ga0466707_378517 Ga0466707_378517_3469_3924 151
86 3300042602 Ga0466713_001234 Ga0466713_001234_5117_5572 151
87 3300042602 Ga0466713_049326 Ga0466713_049326_543_998 151
88 3300042602 Ga0466713_107493 Ga0466713_107493_3209_3664 151
89 3300042602 Ga0466713_118879 Ga0466713_118879_1543_1998 151
90 3300042602 Ga0466713_154447 Ga0466713_154447_2098_2553 151
91 3300042603 Ga0466714_004537 Ga0466714_004537_2009_2464 151
92 3300042605 Ga0466716_103379 Ga0466716_103379_1135_1590 151
93 3300042605 Ga0466716_130562 Ga0466716_130562_2566_3021 151
94 3300042605 Ga0466716_186862 Ga0466716_186862_411_866 151
95 3300042606 Ga0466719_035929 Ga0466719_035929_86_541 151
96 3300042606 Ga0466719_137333 Ga0466719_137333_135_590 151
97 3300042606 Ga0466719_548966 Ga0466719_548966_721_1176 151
98 3300042609 Ga0466722_023951 Ga0466722_023951_1318_1773 151
99 3300042609 Ga0466722_026759 Ga0466722_026759_1651_2106 151
100 3300042609 Ga0466722_115766 Ga0466722_115766_293_748 151
101 3300042609 Ga0466722_132989 Ga0466722_132989_2239_2694 151
102 3300042610 Ga0466698_085231 Ga0466698_085231_1109_1564 151
103 3300042610 Ga0466698_341279 Ga0466698_341279_809_1264 151
104 3300042611 Ga0466697_220463 Ga0466697_220463_467_922 151
105 3300042612 Ga0466705_105693 Ga0466705_105693_21207_21662 151
106 3300042612 Ga0466705_172168 Ga0466705_172168_651_1106 151
107 3300042613 Ga0466710_095685 Ga0466710_095685_500_955 151
108 3300042613 Ga0466710_407187 Ga0466710_407187_333_788 151
109 3300042615 Ga0466711_045977 Ga0466711_045977_12677_13132 151
110 3300042615 Ga0466711_155472 Ga0466711_155472_623_1078 151
111 3300042615 Ga0466711_334516 Ga0466711_334516_7927_8382 151
112 3300042616 Ga0466715_083168 Ga0466715_083168_698_1153 151
113 3300042616 Ga0466715_138910 Ga0466715_138910_2959_3414 151
114 3300042616 Ga0466715_405704 Ga0466715_405704_4807_5262 151
115 3300042616 Ga0466715_636818 Ga0466715_636818_11620_12075 151
116 3300042618 Ga0466723_018026 Ga0466723_018026_6113_6568 151
117 3300042618 Ga0466723_356525 Ga0466723_356525_528_983 151
118 3300042619 Ga0466726_030060 Ga0466726_030060_6630_7085 151
119 3300042619 Ga0466726_051140 Ga0466726_051140_12684_13139 151
120 3300042619 Ga0466726_448473 Ga0466726_448473_1163_1618 151
121 3300042620 Ga0466728_096152 Ga0466728_096152_2121_2576 151
122 3300042620 Ga0466728_266497 Ga0466728_266497_3197_3652 151
123 3300042620 Ga0466728_410479 Ga0466728_410479_447_902 151
124 3300042621 Ga0466729_061452 Ga0466729_061452_5326_5781 151
125 3300042621 Ga0466729_141989 Ga0466729_141989_714_1169 151
126 3300042621 Ga0466729_314350 Ga0466729_314350_123_578 151
127 3300042624 Ga0466735_030140 Ga0466735_030140_587_1042 151
128 3300042624 Ga0466735_051411 Ga0466735_051411_1964_2419 151
129 3300042624 Ga0466735_207810 Ga0466735_207810_158_613 151
130 3300042636 Ga0466703_096275 Ga0466703_096275_2126_2581 151
131 3300042636 Ga0466703_215720 Ga0466703_215720_852_1307 151
132 3300042636 Ga0466703_351907 Ga0466703_351907_279_734 151
133 3300042636 Ga0466703_427727 Ga0466703_427727_2042_2497 151
134 3300042643 Ga0466704_060121 Ga0466704_060121_2604_3059 151
135 3300042643 Ga0466704_304044 Ga0466704_304044_2676_3131 151
136 3300042643 Ga0466704_377212 Ga0466704_377212_2958_3413 151
137 3300042643 Ga0466704_484286 Ga0466704_484286_4081_4536 151
138 3300042648 Ga0466709_114487 Ga0466709_114487_50802_51257 151
139 3300042648 Ga0466709_332846 Ga0466709_332846_551_1006 151
140 3300042652 Ga0466708_176752 Ga0466708_176752_15195_15650 151
141 3300042655 Ga0466727_135560 Ga0466727_135560_2479_2934 151
142 3300042655 Ga0466727_258633 Ga0466727_258633_882_1337 151
143 3300042655 Ga0466727_319003 Ga0466727_319003_32000_32455 151
144 3300042659 Ga0466733_081769 Ga0466733_081769_1486_1941 151
145 3300042659 Ga0466733_108422 Ga0466733_108422_651_1106 151
146 3300042659 Ga0466733_114022 Ga0466733_114022_745_1200 151
147 3300042659 Ga0466733_114930 Ga0466733_114930_49_504 151
148 3300042659 Ga0466733_135976 Ga0466733_135976_602_1057 151
149 iso_pr_bacteria 2811995047 2812946822 151
150 iso_pr_bacteria 2820746860 2820747141 151
151 iso_pr_bacteria 2820750388 2820751001 151
152 iso_pr_bacteria 2820770630 2820770673 151
153 iso_pr_bacteria 2820785563 2820786002 151
154 iso_pr_bacteria 2820788205 2820789692 151
155 iso_pr_bacteria 2864878056 2864879164 151
156 iso_pr_bacteria 2864886855 2864887148 151
157 iso_pr_bacteria 2882250448 2882251176 151
158 iso_pr_bacteria 2904728850 2904731311 151
159 iso_pr_bacteria 2940193328 2940194219 151
160 iso_pr_bacteria 2940216256 2940218098 151
161 iso_pr_bacteria 2940336608 2940337421 151
162 iso_pr_bacteria 2958471994 2958474495 151
163 3300000062 IMNBL1DRAFT_c0000101 IMNBL1DRAFT_000010132 152
164 3300000062 IMNBL1DRAFT_c0000621 IMNBL1DRAFT_000062131 152
165 3300000062 IMNBL1DRAFT_c0001620 IMNBL1DRAFT_000162012 152
166 3300000062 IMNBL1DRAFT_c0003618 IMNBL1DRAFT_00036183 152
167 3300000062 IMNBL1DRAFT_c0013669 IMNBL1DRAFT_00136693 152
168 3300002450 JGI24695J34938_10038248 JGI24695J34938_100382482 152
169 3300002462 JGI24702J35022_10000550 JGI24702J35022_100005503 152
170 3300002462 JGI24702J35022_10000785 JGI24702J35022_1000078514 152
171 3300002462 JGI24702J35022_10062639 JGI24702J35022_100626392 152
172 3300002462 JGI24702J35022_10216698 JGI24702J35022_102166982 152
173 3300002462 JGI24702J35022_10526690 JGI24702J35022_105266901 152
174 3300002504 JGI24705J35276_12103991 JGI24705J35276_121039912 152
175 3300002931 CVPL010W_10000573 CVPL010W_1000057319 152
176 3300005083 Ga0068305_10134089 Ga0068305_101340894 152
177 3300005318 Ga0074188_1007577 Ga0074188_10075772 152
178 3300007068 Ga0103265_1004787 Ga0103265_10047873 152
179 3300007080 Ga0102735_1001952 Ga0102735_10019522 152
180 3300007095 Ga0102739_1000003 Ga0102739_100000359 152
181 3300007129 Ga0102734_1000285 Ga0102734_10002854 152
182 3300007142 Ga0102737_1000001 Ga0102737_100000145 152
183 3300007143 Ga0104048_1169343 Ga0104048_11693432 152
184 3300007149 Ga0104040_1096349 Ga0104040_10963492 152
185 3300007190 Ga0103267_1006592 Ga0103267_10065921 152
186 3300007192 Ga0103268_1000577 Ga0103268_10005774 152
187 3300009784 Ga0123357_10086008 Ga0123357_100860083 152
188 3300009784 Ga0123357_10220445 Ga0123357_102204452 152
189 3300009826 Ga0123355_10000179 Ga0123355_1000017959 152
190 3300009826 Ga0123355_10008077 Ga0123355_100080778 152
191 3300009826 Ga0123355_12177017 Ga0123355_121770171 152
192 3300010049 Ga0123356_10509218 Ga0123356_105092182 152
193 3300010049 Ga0123356_11061270 Ga0123356_110612702 152
194 3300010167 Ga0123353_10000028 Ga0123353_1000002843 152
195 3300010167 Ga0123353_10309181 Ga0123353_103091814 152
196 3300010167 Ga0123353_11317785 Ga0123353_113177852 152
197 3300010882 Ga0123354_10099996 Ga0123354_100999964 152
198 3300010882 Ga0123354_10335293 Ga0123354_103352933 152
199 3300042602 Ga0466713_149519 Ga0466713_149519_3661_4119 152
200 3300042624 Ga0466735_015791 Ga0466735_015791_7266_7727 153
201 3300005083 Ga0068305_10189950 Ga0068305_101899503 154
202 3300042649 Ga0466724_02020 Ga0466724_02020_169_639 156
203 3300010049 Ga0123356_10377686 Ga0123356_103776862 160
204 3300042636 Ga0466703_177584 Ga0466703_177584_2240_2722 160
205 3300007143 Ga0104048_1003309 Ga0104048_10033092 162
206 3300007767 Ga0105553_1033704 Ga0105553_10337044 162
207 3300010882 Ga0123354_10329179 Ga0123354_103291793 163
208 3300042597 Ga0466699_091643 Ga0466699_091643_43_537 164
209 3300042643 Ga0466704_485915 Ga0466704_485915_134_649 171
210 3300042619 Ga0466726_264348 Ga0466726_264348_5160_5678 172
211 3300042590 Ga0466690_092486 Ga0466690_092486_9974_10522 182

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 18 145 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.