Protein Family IF09173

Metagenome Isolate
315 Members
112 Samples
267 Scaffolds
131.76 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_176395|Ga0466703_176395_1924_2400
Length
158 aa
Sequence
MRNYAKQKSVMSVKYCSENPNQFNLNFMTDPIADYLTRLRNAIKAKHRVVDIPASNLKKEITKILFDKGYILNYKFVEEGPQGTIKIALKYNLVNKVNAIKNLKRVSSPGLRRYAGYKEMPRVLNGLGVAVLSTSKGVMTDKEARDQKIGGEVLCYIY

πŸ“Š Sample Types

Isolate 15.2%
Metagenome 84.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 21.7%
Termitidae 21.7%
Kalotermitidae 13.2%
Unclassified 10.4%
Rhinotermitidae 5.7%
Formicidae 4.7%
Blattellidae 3.8%
Termopsidae 3.8%
Passalidae 2.8%
Drosophilidae 2.8%
Hydrophilidae 1.9%
Daphniidae 0.9%
Pseudophyllodromiidae 0.9%
Cryptocercidae 0.9%
Hodotermitidae 0.9%
Bombycidae 0.9%
Blaberidae 0.9%
Tenebrionidae 0.9%
Nephropidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 298
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
2 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
3 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
4 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
5 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
6 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
7 3002008998 Blattabacterium cuenoti PARCOBvir Isolate Blattellidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
10 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
11 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
12 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
18 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
19 3002002726 Blattabacterium cuenoti PARATEMsp Isolate Blattellidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
24 650716011 Blattabacterium sp. Bge Isolate Blattellidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
33 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
34 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
35 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
36 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
37 3002026254 Blattabacterium cuenoti BALTAsp Isolate Pseudophyllodromiidae
38 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
39 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
42 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
43 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
44 3300010053 Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA Metagenome Cryptocercidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
49 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
50 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
54 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
55 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
56 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
57 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
58 2898741527 Sphingobacterium sp. xlx-73 Isolate
59 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
60 3001995318 Blattabacterium cuenoti DYAKIkur Isolate Blattellidae
61 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
62 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
63 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
64 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
65 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
66 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
67 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
68 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
69 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
70 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
71 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
72 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
73 2896321640 Sphingobacterium sp. xlx-130 Isolate
74 2922326829 Bacteroides sp. 224 Isolate Blattidae
75 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
76 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
77 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
78 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
79 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
80 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
81 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
82 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
83 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
84 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
85 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
86 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
87 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
88 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
89 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
90 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
91 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
92 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
93 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
94 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
95 2896330536 Sphingobacterium sp. xlx-96 Isolate
96 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
97 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
98 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
99 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
100 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
101 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
102 2896350215 Sphingobacterium sp. xlx-183 Isolate
103 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
104 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
105 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
106 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
107 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
108 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
109 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
110 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
111 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
112 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0134290_1112291 3300010053 Unclassified 618
2 2227290536 2225789004 Unclassified 1241
3 2227471891 2225789004 Bacteria 917
4 IMNBL1DRAFT_c0000687 3300000062 Bacteria 27159
5 IMNBL1DRAFT_c0003450 3300000062 Bacteria 10155
6 JGI24705J35276_12227509 3300002504 Bacteria 3016
7 Ga0068305_10015112 3300005083 Bacteria 28238
8 Ga0102735_1002384 3300007080 Bacteria 2870
9 Ga0466703_249699 3300042636 Bacteria 47455
10 Ga0466704_533188 3300042643 Bacteria 20326
11 Ga0466727_260920 3300042655 Bacteria 6356
12 Ga0466712_053087 3300042614 Bacteria 1959
13 Ga0466711_469917 3300042615 Bacteria 2363
14 Ga0466715_434053 3300042616 Bacteria 17606
15 Ga0466723_373256 3300042618 Bacteria 33738
16 Ga0466726_462884 3300042619 Bacteria 2272
17 Ga0466728_292510 3300042620 Bacteria 40918
18 Ga0466696_019411 3300042596 Bacteria 1333
19 Ga0466696_479576 3300042596 Bacteria 3153
20 Ga0466701_098566 3300042598 Bacteria 20155
21 Ga0466706_206977 3300042599 Bacteria 1438
22 Ga0466700_143196 3300042600 Bacteria 14202
23 Ga0466707_398960 3300042601 Bacteria 15809
24 Ga0466713_127060 3300042602 Bacteria 78606
25 Ga0466713_137499 3300042602 Bacteria 46639
26 Ga0466722_210785 3300042609 Bacteria 4412
27 Ga0466697_212074 3300042611 Bacteria 3433
28 Ga0466705_350476 3300042612 Bacteria 1615
29 Ga0466733_208857 3300042659 Bacteria 1348
30 Ga0562377_0004 3300056842 Bacteria 3525959
31 Ga0123357_10132820 3300009784 Unclassified 3091
32 Ga0123354_10000498 3300010882 Bacteria 39457
33 JGI24702J35022_10004210 3300002462 Bacteria 8590
34 Ga0068305_10085917 3300005083 Bacteria 6918
35 Ga0104045_1006496 3300007085 Bacteria 6140
36 Ga0104041_1128281 3300007106 Bacteria 789
37 Ga0466735_207101 3300042624 Unclassified 1064
38 Ga0466703_105741 3300042636 Bacteria 30105
39 Ga0466703_234996 3300042636 Bacteria 1132
40 Ga0466708_014146 3300042652 Bacteria 33245
41 Ga0466728_421279 3300042620 Bacteria 4461
42 Ga0160441_100482 3300012825 Bacteria 29148
43 Ga0466690_110824 3300042590 Bacteria 8694
44 Ga0466690_163569 3300042590 Bacteria 16378
45 Ga0466690_212563 3300042590 Bacteria 2638
46 Ga0466696_201817 3300042596 Bacteria 41274
47 Ga0466696_312122 3300042596 Bacteria 7170
48 Ga0466707_141064 3300042601 Bacteria 19817
49 Ga0466713_079678 3300042602 Bacteria 62372
50 Ga0466713_129806 3300042602 Bacteria 35433
51 Ga0466722_052375 3300042609 Bacteria 1188
52 Ga0466722_207156 3300042609 Bacteria 3849
53 Ga0466698_381561 3300042610 Bacteria 3036
54 Ga0466697_139692 3300042611 Bacteria 246544
55 Ga0466705_301731 3300042612 Bacteria 5712
56 Ga0123357_10370376 3300009784 Bacteria 1343
57 Ga0123353_10000019 3300010167 Bacteria 185006
58 Ga0123353_10164495 3300010167 Bacteria 3528
59 IMNBGM34_c004877 3300000036 Bacteria 1797
60 IMNBL1DRAFT_c0000677 3300000062 Bacteria 27305
61 IMNBL1DRAFT_c0012380 3300000062 Bacteria 3905
62 JGI24698J34947_10009875 3300002449 Bacteria 5232
63 JGI24702J35022_10002597 3300002462 Bacteria 10970
64 JGI24702J35022_10029452 3300002462 Bacteria 2947
65 Ga0068302_10164744 3300005071 Bacteria 1908
66 Ga0072941_1545031 3300005201 Bacteria 1420
67 Ga0466704_192770 3300042643 Bacteria 2947
68 Ga0466704_469392 3300042643 Bacteria 2729
69 Ga0466708_462678 3300042652 Bacteria 4616
70 Ga0466725_037990 3300042654 Bacteria 18222
71 Ga0466725_255972 3300042654 Bacteria 39464
72 Ga0466711_120016 3300042615 Bacteria 45710
73 Ga0466711_226259 3300042615 Bacteria 4193
74 Ga0466711_486497 3300042615 Bacteria 6767
75 Ga0466715_153338 3300042616 Bacteria 101125
76 Ga0466726_024142 3300042619 Bacteria 22843
77 Ga0466726_242160 3300042619 Bacteria 13880
78 Ga0466728_371680 3300042620 Bacteria 8915
79 Ga0466690_075785 3300042590 Bacteria 45904
80 Ga0466690_248346 3300042590 Bacteria 4114
81 Ga0466692_009748 3300042591 Unclassified 1324
82 Ga0466691_066359 3300042593 Bacteria 26336
83 Ga0466696_090243 3300042596 Bacteria 10365
84 Ga0466696_326056 3300042596 Bacteria 4113
85 Ga0466706_217013 3300042599 Bacteria 1916
86 Ga0466706_237229 3300042599 Bacteria 5073
87 Ga0466713_021681 3300042602 Bacteria 1307
88 Ga0466713_027800 3300042602 Bacteria 40167
89 Ga0466713_035081 3300042602 Bacteria 6541
90 Ga0466713_083156 3300042602 Unclassified 1291
91 Ga0466716_240704 3300042605 Bacteria 7499
92 Ga0466722_073972 3300042609 Bacteria 128406
93 Ga0466722_127886 3300042609 Bacteria 6387
94 Ga0466732_238214 3300042656 Bacteria 1778
95 Ga0466732_296537 3300042656 Bacteria 1670
96 Ga0466733_028819 3300042659 Bacteria 27870
97 Ga0123356_10396936 3300010049 Bacteria 1516
98 Ga0123356_10446596 3300010049 Bacteria 1440
99 Ga0123356_10882630 3300010049 Unclassified 1065
100 Ga0123353_10418276 3300010167 Bacteria 1987
101 Ga0123353_10523992 3300010167 Bacteria 1719
102 Ga0123353_11213897 3300010167 Bacteria 988
103 Ga0123353_12032916 3300010167 Bacteria 702
104 2227466257 2225789004 Bacteria 966
105 IMNBL1DRAFT_c0000119 3300000062 Bacteria 71190
106 JGI24702J35022_10008763 3300002462 Bacteria 5711
107 Ga0068305_10010112 3300005083 Bacteria 17726
108 Ga0103263_101903 3300007042 Bacteria 2647
109 Ga0102740_1000340 3300007140 Bacteria 13154
110 Ga0466735_071242 3300042624 Bacteria 4680
111 Ga0466703_027519 3300042636 Bacteria 2324
112 Ga0466703_109702 3300042636 Bacteria 21153
113 Ga0466703_279649 3300042636 Bacteria 29017
114 Ga0466703_369160 3300042636 Bacteria 28465
115 Ga0466724_53803 3300042649 Bacteria 7886
116 Ga0466727_009300 3300042655 Bacteria 1757
117 Ga0466727_175984 3300042655 Bacteria 3199
118 Ga0466727_231897 3300042655 Bacteria 4151
119 Ga0466727_289772 3300042655 Bacteria 14123
120 Ga0466711_086148 3300042615 Bacteria 1881
121 Ga0466715_044375 3300042616 Bacteria 14700
122 Ga0466715_231188 3300042616 Bacteria 1518
123 Ga0466715_610116 3300042616 Bacteria 1104
124 Ga0466692_157620 3300042591 Bacteria 1082
125 Ga0466692_161873 3300042591 Bacteria 51547
126 Ga0466691_107488 3300042593 Bacteria 2026
127 Ga0466707_194386 3300042601 Bacteria 27039
128 Ga0466707_207725 3300042601 Bacteria 3855
129 Ga0466713_026562 3300042602 Bacteria 15627
130 Ga0466713_096596 3300042602 Bacteria 406546
131 Ga0466713_113019 3300042602 Bacteria 16771
132 Ga0466714_107938 3300042603 Bacteria 5958
133 Ga0466719_292822 3300042606 Bacteria 42754
134 Ga0466722_108524 3300042609 Bacteria 6122
135 Ga0466722_143981 3300042609 Bacteria 20003
136 Ga0466705_058096 3300042612 Bacteria 11192
137 Ga0466733_052339 3300042659 Bacteria 35317
138 Ga0466733_074718 3300042659 Bacteria 2991
139 Ga0466733_144713 3300042659 Bacteria 6687
140 Ga0466733_197911 3300042659 Bacteria 1964
141 Ga0123357_10040344 3300009784 Bacteria 6346
142 Ga0123357_10057959 3300009784 Bacteria 5203
143 Ga0123356_12449715 3300010049 Bacteria 653
144 IMNBL1DRAFT_c0000355 3300000062 Bacteria 38787
145 IMNBL1DRAFT_c0000682 3300000062 Bacteria 27226
146 IMNBL1DRAFT_c0041101 3300000062 Bacteria 1557
147 IMNBL1DRAFT_c0068657 3300000062 Unclassified 1032
148 JGI24705J35276_12164918 3300002504 Bacteria 1255
149 JGI24705J35276_12219018 3300002504 Bacteria 2179
150 JGI24699J35502_11133946 3300002509 Bacteria 20622
151 Ga0068305_10026156 3300005083 Bacteria 20761
152 Ga0068305_10103751 3300005083 Bacteria 1616
153 Ga0466729_243779 3300042621 Bacteria 6142
154 Ga0466735_014617 3300042624 Bacteria 1887
155 Ga0466735_078473 3300042624 Bacteria 1166
156 Ga0466735_152196 3300042624 Bacteria 3972
157 Ga0466704_017562 3300042643 Unclassified 1905
158 Ga0466704_541626 3300042643 Bacteria 3198
159 Ga0466725_286288 3300042654 Bacteria 3552
160 Ga0466710_039997 3300042613 Bacteria 3114
161 Ga0466711_011252 3300042615 Bacteria 11053
162 Ga0466711_189861 3300042615 Bacteria 40824
163 Ga0466715_045203 3300042616 Bacteria 21834
164 Ga0466715_177954 3300042616 Bacteria 14578
165 Ga0466715_372457 3300042616 Bacteria 41034
166 Ga0466723_219374 3300042618 Unclassified 1807
167 Ga0466726_271572 3300042619 Bacteria 26331
168 Ga0466728_018673 3300042620 Bacteria 22808
169 Ga0466692_188243 3300042591 Bacteria 86416
170 Ga0466691_045847 3300042593 Bacteria 49393
171 Ga0466691_103922 3300042593 Bacteria 19126
172 Ga0466696_079953 3300042596 Bacteria 4070
173 Ga0466701_076335 3300042598 Bacteria 60822
174 Ga0466713_039539 3300042602 Unclassified 7063
175 Ga0466716_501317 3300042605 Bacteria 2818
176 Ga0466719_469556 3300042606 Unclassified 1070
177 Ga0466722_117304 3300042609 Bacteria 122884
178 Ga0466705_023652 3300042612 Bacteria 16774
179 Ga0466705_384350 3300042612 Bacteria 1149
180 Ga0123356_11630111 3300010049 Bacteria 799
181 Ga0134290_1264530 3300010053 Bacteria 705
182 Ga0123353_10003138 3300010167 Bacteria 20743
183 Ga0123353_11360614 3300010167 Unclassified 916
184 2227473843 2225789004 Bacteria 902
185 JGI24702J35022_10453175 3300002462 Bacteria 781
186 JGI24699J35502_11134150 3300002509 Bacteria 37878
187 JGI24696J40584_12957240 3300002834 Bacteria 3416
188 Ga0104041_1111365 3300007106 Bacteria 2017
189 Ga0466731_134384 3300042622 Unclassified 1025
190 Ga0466703_073446 3300042636 Bacteria 8423
191 Ga0466704_415186 3300042643 Bacteria 17633
192 Ga0466709_266727 3300042648 Bacteria 3133
193 Ga0466705_502503 3300042612 Bacteria 16070
194 Ga0466711_228133 3300042615 Bacteria 7712
195 Ga0466715_013468 3300042616 Bacteria 26887
196 Ga0466715_253613 3300042616 Bacteria 5665
197 Ga0466723_093881 3300042618 Bacteria 35007
198 Ga0466692_149579 3300042591 Bacteria 83669
199 Ga0466692_183985 3300042591 Bacteria 2926
200 Ga0466696_089029 3300042596 Bacteria 1061
201 Ga0466700_405093 3300042600 Bacteria 5125
202 Ga0466707_157624 3300042601 Bacteria 13208
203 Ga0466707_190959 3300042601 Bacteria 10157
204 Ga0466713_017440 3300042602 Bacteria 108493
205 Ga0466713_051789 3300042602 Bacteria 1591
206 Ga0466713_072740 3300042602 Bacteria 29878
207 Ga0466713_121249 3300042602 Bacteria 3201
208 Ga0466714_150740 3300042603 Bacteria 1489
209 Ga0466716_335360 3300042605 Bacteria 11224
210 Ga0466698_327264 3300042610 Bacteria 8551
211 Ga0466705_019476 3300042612 Bacteria 24974
212 Ga0466727_352642 3300042655 Bacteria 45291
213 2227477137 2225789004 Bacteria 4589
214 JGI24702J35022_10227061 3300002462 Bacteria 1078
215 Ga0068305_10061301 3300005083 Bacteria 11640
216 Ga0466729_282192 3300042621 Bacteria 3746
217 Ga0466735_064263 3300042624 Bacteria 2824
218 Ga0466735_177951 3300042624 Bacteria 10162
219 Ga0466703_019525 3300042636 Bacteria 29012
220 Ga0466703_176395 3300042636 Bacteria 15139
221 Ga0466704_432261 3300042643 Bacteria 4580
222 Ga0466704_552057 3300042643 Bacteria 6449
223 Ga0466704_619871 3300042643 Bacteria 22946
224 Ga0466709_235305 3300042648 Bacteria 3321
225 Ga0466715_076088 3300042616 Bacteria 9712
226 Ga0466718_124700 3300042617 Bacteria 1135
227 Ga0466729_056072 3300042621 Bacteria 21161
228 Ga0456237_0000012 3300041968 Bacteria 42362
229 Ga0466693_219635 3300042592 Bacteria 3760
230 Ga0466696_040254 3300042596 Bacteria 1680
231 Ga0466701_050773 3300042598 Bacteria 1055
232 Ga0466707_152952 3300042601 Bacteria 15357
233 Ga0466713_022772 3300042602 Bacteria 15388
234 Ga0466714_096666 3300042603 Bacteria 172614
235 Ga0466716_231031 3300042605 Bacteria 6941
236 Ga0466719_246678 3300042606 Bacteria 8577
237 Ga0466722_077240 3300042609 Bacteria 7055
238 Ga0466722_161726 3300042609 Bacteria 14778
239 Ga0466705_373160 3300042612 Bacteria 25790
240 Ga0466733_221527 3300042659 Bacteria 2376
241 Ga0123356_12779224 3300010049 Bacteria 613
242 2227133585 2225789004 Bacteria 8869
243 JGI24702J35022_10744811 3300002462 Unclassified 610
244 CVPL010W_10000676 3300002931 Bacteria 64066
245 Ga0102734_1006096 3300007129 Unclassified 2696
246 Ga0104050_1212478 3300007153 Bacteria 897
247 Ga0466729_318464 3300042621 Bacteria 5684
248 Ga0466724_28405 3300042649 Bacteria 7792
249 Ga0466727_040337 3300042655 Bacteria 31698
250 Ga0466727_050462 3300042655 Bacteria 20965
251 Ga0466710_178175 3300042613 Bacteria 2134
252 Ga0466711_050658 3300042615 Bacteria 24311
253 Ga0466715_265725 3300042616 Bacteria 12007
254 Ga0466726_361642 3300042619 Bacteria 6372
255 Ga0466726_494833 3300042619 Bacteria 4829
256 Ga0466690_032772 3300042590 Bacteria 29534
257 Ga0466690_175771 3300042590 Bacteria 56622
258 Ga0466691_039529 3300042593 Bacteria 29822
259 Ga0466706_169251 3300042599 Bacteria 2322
260 Ga0466700_076796 3300042600 Bacteria 9313
261 Ga0466700_458823 3300042600 Unclassified 1242
262 Ga0466707_123522 3300042601 Bacteria 8117
263 Ga0466707_374739 3300042601 Bacteria 28797
264 Ga0466713_018853 3300042602 Bacteria 13634
265 Ga0466713_112803 3300042602 Bacteria 145809
266 Ga0466719_204065 3300042606 Bacteria 20051
267 Ga0466719_214476 3300042606 Bacteria 1782

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 3001995318 3001995711 127
2 iso_pr_bacteria 3002002726 3002003125 127
3 iso_pr_bacteria 3002007112 3002007497 127
4 iso_pr_bacteria 3002008998 3002009396 127
5 iso_pr_bacteria 650716011 650720019 127
6 iso_pr_bacteria 2820759988 2820760001 128
7 iso_pr_bacteria 3002026254 3002026625 129
8 2225789004 2227133585 2227531738 131
9 2225789004 2227466257 2227905245 131
10 2225789004 2227471891 2227919133 131
11 2225789004 2227473843 2227923219 131
12 2225789004 2227477137 2227930537 131
13 3300041968 Ga0456237_0000012 Ga0456237_0000012_6043_6438 131
14 3300042590 Ga0466690_032772 Ga0466690_032772_24377_24772 131
15 3300042590 Ga0466690_075785 Ga0466690_075785_12152_12547 131
16 3300042590 Ga0466690_110824 Ga0466690_110824_565_960 131
17 3300042590 Ga0466690_163569 Ga0466690_163569_8397_8792 131
18 3300042590 Ga0466690_175771 Ga0466690_175771_43708_44103 131
19 3300042590 Ga0466690_212563 Ga0466690_212563_1686_2081 131
20 3300042590 Ga0466690_248346 Ga0466690_248346_268_663 131
21 3300042591 Ga0466692_009748 Ga0466692_009748_704_1099 131
22 3300042591 Ga0466692_149579 Ga0466692_149579_9700_10095 131
23 3300042591 Ga0466692_157620 Ga0466692_157620_667_1062 131
24 3300042591 Ga0466692_161873 Ga0466692_161873_6599_6994 131
25 3300042591 Ga0466692_183985 Ga0466692_183985_1873_2268 131
26 3300042591 Ga0466692_188243 Ga0466692_188243_36564_36959 131
27 3300042593 Ga0466691_039529 Ga0466691_039529_18855_19250 131
28 3300042593 Ga0466691_045847 Ga0466691_045847_21683_22078 131
29 3300042593 Ga0466691_066359 Ga0466691_066359_12263_12658 131
30 3300042593 Ga0466691_103922 Ga0466691_103922_9582_9977 131
31 3300042593 Ga0466691_107488 Ga0466691_107488_568_963 131
32 3300042596 Ga0466696_019411 Ga0466696_019411_511_906 131
33 3300042596 Ga0466696_040254 Ga0466696_040254_86_481 131
34 3300042596 Ga0466696_079953 Ga0466696_079953_1025_1420 131
35 3300042596 Ga0466696_089029 Ga0466696_089029_454_849 131
36 3300042596 Ga0466696_090243 Ga0466696_090243_8208_8603 131
37 3300042596 Ga0466696_201817 Ga0466696_201817_2078_2473 131
38 3300042596 Ga0466696_312122 Ga0466696_312122_685_1080 131
39 3300042596 Ga0466696_326056 Ga0466696_326056_1004_1399 131
40 3300042596 Ga0466696_479576 Ga0466696_479576_340_735 131
41 3300042598 Ga0466701_050773 Ga0466701_050773_440_835 131
42 3300042598 Ga0466701_076335 Ga0466701_076335_4989_5384 131
43 3300042598 Ga0466701_098566 Ga0466701_098566_1201_1596 131
44 3300042599 Ga0466706_169251 Ga0466706_169251_1261_1656 131
45 3300042599 Ga0466706_206977 Ga0466706_206977_13_408 131
46 3300042599 Ga0466706_217013 Ga0466706_217013_355_750 131
47 3300042599 Ga0466706_237229 Ga0466706_237229_3599_3994 131
48 3300042600 Ga0466700_076796 Ga0466700_076796_834_1229 131
49 3300042600 Ga0466700_143196 Ga0466700_143196_9422_9817 131
50 3300042600 Ga0466700_405093 Ga0466700_405093_4257_4652 131
51 3300042600 Ga0466700_458823 Ga0466700_458823_355_750 131
52 3300042601 Ga0466707_123522 Ga0466707_123522_190_585 131
53 3300042601 Ga0466707_141064 Ga0466707_141064_15016_15411 131
54 3300042601 Ga0466707_152952 Ga0466707_152952_6425_6820 131
55 3300042601 Ga0466707_157624 Ga0466707_157624_6566_6961 131
56 3300042601 Ga0466707_190959 Ga0466707_190959_1965_2360 131
57 3300042601 Ga0466707_194386 Ga0466707_194386_10850_11245 131
58 3300042601 Ga0466707_207725 Ga0466707_207725_2859_3254 131
59 3300042601 Ga0466707_374739 Ga0466707_374739_13311_13706 131
60 3300042601 Ga0466707_398960 Ga0466707_398960_5096_5491 131
61 3300042602 Ga0466713_017440 Ga0466713_017440_103134_103529 131
62 3300042602 Ga0466713_018853 Ga0466713_018853_2985_3380 131
63 3300042602 Ga0466713_021681 Ga0466713_021681_61_456 131
64 3300042602 Ga0466713_022772 Ga0466713_022772_8006_8401 131
65 3300042602 Ga0466713_026562 Ga0466713_026562_2279_2674 131
66 3300042602 Ga0466713_027800 Ga0466713_027800_11855_12250 131
67 3300042602 Ga0466713_035081 Ga0466713_035081_3811_4206 131
68 3300042602 Ga0466713_039539 Ga0466713_039539_5615_6010 131
69 3300042602 Ga0466713_051789 Ga0466713_051789_144_539 131
70 3300042602 Ga0466713_072740 Ga0466713_072740_16477_16872 131
71 3300042602 Ga0466713_079678 Ga0466713_079678_52498_52893 131
72 3300042602 Ga0466713_083156 Ga0466713_083156_61_456 131
73 3300042602 Ga0466713_096596 Ga0466713_096596_319446_319841 131
74 3300042602 Ga0466713_112803 Ga0466713_112803_17753_18148 131
75 3300042602 Ga0466713_127060 Ga0466713_127060_65914_66309 131
76 3300042602 Ga0466713_129806 Ga0466713_129806_11422_11817 131
77 3300042602 Ga0466713_137499 Ga0466713_137499_17887_18282 131
78 3300042603 Ga0466714_096666 Ga0466714_096666_23084_23479 131
79 3300042603 Ga0466714_150740 Ga0466714_150740_217_612 131
80 3300042605 Ga0466716_231031 Ga0466716_231031_6536_6931 131
81 3300042605 Ga0466716_240704 Ga0466716_240704_1025_1420 131
82 3300042605 Ga0466716_335360 Ga0466716_335360_2699_3094 131
83 3300042605 Ga0466716_501317 Ga0466716_501317_1825_2220 131
84 3300042606 Ga0466719_204065 Ga0466719_204065_9081_9476 131
85 3300042606 Ga0466719_214476 Ga0466719_214476_880_1275 131
86 3300042606 Ga0466719_246678 Ga0466719_246678_7641_8036 131
87 3300042606 Ga0466719_292822 Ga0466719_292822_23205_23600 131
88 3300042606 Ga0466719_469556 Ga0466719_469556_616_1011 131
89 3300042609 Ga0466722_052375 Ga0466722_052375_81_476 131
90 3300042609 Ga0466722_073972 Ga0466722_073972_21280_21675 131
91 3300042609 Ga0466722_077240 Ga0466722_077240_5241_5636 131
92 3300042609 Ga0466722_108524 Ga0466722_108524_5288_5683 131
93 3300042609 Ga0466722_117304 Ga0466722_117304_91605_92000 131
94 3300042609 Ga0466722_127886 Ga0466722_127886_979_1374 131
95 3300042609 Ga0466722_143981 Ga0466722_143981_8782_9177 131
96 3300042609 Ga0466722_161726 Ga0466722_161726_6119_6514 131
97 3300042609 Ga0466722_207156 Ga0466722_207156_1746_2141 131
98 3300042609 Ga0466722_210785 Ga0466722_210785_157_552 131
99 3300042610 Ga0466698_381561 Ga0466698_381561_783_1178 131
100 3300042611 Ga0466697_139692 Ga0466697_139692_206689_207084 131
101 3300042611 Ga0466697_212074 Ga0466697_212074_2426_2821 131
102 3300042612 Ga0466705_019476 Ga0466705_019476_6439_6834 131
103 3300042612 Ga0466705_023652 Ga0466705_023652_6447_6842 131
104 3300042612 Ga0466705_058096 Ga0466705_058096_1473_1868 131
105 3300042612 Ga0466705_350476 Ga0466705_350476_146_541 131
106 3300042612 Ga0466705_384350 Ga0466705_384350_554_949 131
107 3300042612 Ga0466705_502503 Ga0466705_502503_7259_7654 131
108 3300042613 Ga0466710_039997 Ga0466710_039997_2210_2605 131
109 3300042614 Ga0466712_053087 Ga0466712_053087_383_778 131
110 3300042615 Ga0466711_011252 Ga0466711_011252_274_669 131
111 3300042615 Ga0466711_050658 Ga0466711_050658_9336_9731 131
112 3300042615 Ga0466711_120016 Ga0466711_120016_22167_22562 131
113 3300042615 Ga0466711_189861 Ga0466711_189861_4224_4619 131
114 3300042615 Ga0466711_226259 Ga0466711_226259_46_441 131
115 3300042615 Ga0466711_228133 Ga0466711_228133_1167_1562 131
116 3300042615 Ga0466711_486497 Ga0466711_486497_6011_6406 131
117 3300042616 Ga0466715_013468 Ga0466715_013468_22170_22565 131
118 3300042616 Ga0466715_044375 Ga0466715_044375_13591_13986 131
119 3300042616 Ga0466715_045203 Ga0466715_045203_8697_9092 131
120 3300042616 Ga0466715_076088 Ga0466715_076088_362_757 131
121 3300042616 Ga0466715_153338 Ga0466715_153338_50266_50661 131
122 3300042616 Ga0466715_177954 Ga0466715_177954_10836_11231 131
123 3300042616 Ga0466715_231188 Ga0466715_231188_452_847 131
124 3300042616 Ga0466715_253613 Ga0466715_253613_4880_5275 131
125 3300042616 Ga0466715_265725 Ga0466715_265725_5057_5452 131
126 3300042616 Ga0466715_372457 Ga0466715_372457_31856_32251 131
127 3300042616 Ga0466715_434053 Ga0466715_434053_10127_10522 131
128 3300042616 Ga0466715_610116 Ga0466715_610116_244_639 131
129 3300042617 Ga0466718_124700 Ga0466718_124700_323_718 131
130 3300042618 Ga0466723_093881 Ga0466723_093881_11295_11690 131
131 3300042618 Ga0466723_219374 Ga0466723_219374_660_1055 131
132 3300042618 Ga0466723_373256 Ga0466723_373256_8268_8663 131
133 3300042619 Ga0466726_024142 Ga0466726_024142_9341_9736 131
134 3300042619 Ga0466726_242160 Ga0466726_242160_6043_6438 131
135 3300042619 Ga0466726_271572 Ga0466726_271572_10394_10789 131
136 3300042619 Ga0466726_361642 Ga0466726_361642_4515_4910 131
137 3300042619 Ga0466726_462884 Ga0466726_462884_643_1038 131
138 3300042619 Ga0466726_494833 Ga0466726_494833_2833_3228 131
139 3300042620 Ga0466728_018673 Ga0466728_018673_11568_11963 131
140 3300042620 Ga0466728_292510 Ga0466728_292510_23886_24281 131
141 3300042620 Ga0466728_371680 Ga0466728_371680_2606_3001 131
142 3300042621 Ga0466729_056072 Ga0466729_056072_18968_19363 131
143 3300042621 Ga0466729_243779 Ga0466729_243779_3861_4256 131
144 3300042621 Ga0466729_282192 Ga0466729_282192_2581_2976 131
145 3300042621 Ga0466729_318464 Ga0466729_318464_4916_5311 131
146 3300042622 Ga0466731_134384 Ga0466731_134384_23_418 131
147 3300042624 Ga0466735_014617 Ga0466735_014617_529_924 131
148 3300042624 Ga0466735_064263 Ga0466735_064263_2348_2743 131
149 3300042624 Ga0466735_071242 Ga0466735_071242_3154_3549 131
150 3300042624 Ga0466735_078473 Ga0466735_078473_27_422 131
151 3300042624 Ga0466735_152196 Ga0466735_152196_1322_1717 131
152 3300042624 Ga0466735_177951 Ga0466735_177951_3859_4254 131
153 3300042624 Ga0466735_207101 Ga0466735_207101_124_519 131
154 3300042636 Ga0466703_019525 Ga0466703_019525_21996_22391 131
155 3300042636 Ga0466703_027519 Ga0466703_027519_290_685 131
156 3300042636 Ga0466703_073446 Ga0466703_073446_2639_3034 131
157 3300042636 Ga0466703_105741 Ga0466703_105741_29098_29493 131
158 3300042636 Ga0466703_109702 Ga0466703_109702_10265_10660 131
159 3300042636 Ga0466703_234996 Ga0466703_234996_115_510 131
160 3300042636 Ga0466703_249699 Ga0466703_249699_37439_37834 131
161 3300042636 Ga0466703_279649 Ga0466703_279649_7802_8197 131
162 3300042636 Ga0466703_369160 Ga0466703_369160_8193_8588 131
163 3300042643 Ga0466704_017562 Ga0466704_017562_1039_1434 131
164 3300042643 Ga0466704_415186 Ga0466704_415186_4791_5186 131
165 3300042643 Ga0466704_432261 Ga0466704_432261_3436_3831 131
166 3300042643 Ga0466704_533188 Ga0466704_533188_1288_1683 131
167 3300042643 Ga0466704_552057 Ga0466704_552057_4774_5169 131
168 3300042643 Ga0466704_619871 Ga0466704_619871_1854_2249 131
169 3300042648 Ga0466709_235305 Ga0466709_235305_2541_2936 131
170 3300042648 Ga0466709_266727 Ga0466709_266727_2293_2688 131
171 3300042652 Ga0466708_014146 Ga0466708_014146_11296_11691 131
172 3300042652 Ga0466708_462678 Ga0466708_462678_1507_1902 131
173 3300042655 Ga0466727_009300 Ga0466727_009300_1154_1549 131
174 3300042655 Ga0466727_040337 Ga0466727_040337_16886_17281 131
175 3300042655 Ga0466727_050462 Ga0466727_050462_8373_8768 131
176 3300042655 Ga0466727_175984 Ga0466727_175984_71_466 131
177 3300042655 Ga0466727_231897 Ga0466727_231897_979_1374 131
178 3300042655 Ga0466727_260920 Ga0466727_260920_957_1352 131
179 3300042655 Ga0466727_289772 Ga0466727_289772_6028_6423 131
180 3300042655 Ga0466727_352642 Ga0466727_352642_18676_19071 131
181 3300042656 Ga0466732_238214 Ga0466732_238214_577_972 131
182 3300042656 Ga0466732_296537 Ga0466732_296537_314_709 131
183 3300042659 Ga0466733_028819 Ga0466733_028819_17215_17610 131
184 3300042659 Ga0466733_052339 Ga0466733_052339_25358_25753 131
185 3300042659 Ga0466733_074718 Ga0466733_074718_1128_1523 131
186 3300042659 Ga0466733_197911 Ga0466733_197911_597_992 131
187 3300042659 Ga0466733_208857 Ga0466733_208857_518_913 131
188 3300042659 Ga0466733_221527 Ga0466733_221527_1638_2033 131
189 3300056842 Ga0562377_0004 Ga0562377_0004_3474338_3474733 131
190 iso_pr_bacteria 2695420314 2695473226 131
191 iso_pr_bacteria 2695420317 2695484888 131
192 iso_pr_bacteria 2695420931 2698110957 131
193 iso_pr_bacteria 2820757377 2820758089 131
194 iso_pr_bacteria 2820762746 2820764327 131
195 iso_pr_bacteria 2873600114 2873602053 131
196 iso_pr_bacteria 2873610414 2873612414 131
197 iso_pr_bacteria 2910959314 2910959524 131
198 iso_pr_bacteria 2922326829 2922327965 131
199 iso_pr_bacteria 2940193328 2940194737 131
200 iso_pr_bacteria 2940195863 2940197465 131
201 iso_pr_bacteria 2940202316 2940204407 131
202 iso_pr_bacteria 2940205530 2940208427 131
203 iso_pr_bacteria 2940212447 2940215371 131
204 iso_pr_bacteria 2940244548 2940244783 131
205 iso_pr_bacteria 2940248789 2940249023 131
206 iso_pr_bacteria 2940253009 2940253251 131
207 iso_pr_bacteria 2940257232 2940257697 131
208 iso_pr_bacteria 2940298504 2940301425 131
209 iso_pr_bacteria 2940302308 2940305227 131
210 iso_pr_bacteria 2940306115 2940309014 131
211 iso_pr_bacteria 2940309933 2940312883 131
212 iso_pr_bacteria 2940313741 2940316696 131
213 iso_pr_bacteria 2940317558 2940320511 131
214 iso_pr_bacteria 2940321370 2940324267 131
215 iso_pr_bacteria 2940325180 2940328067 131
216 iso_pr_bacteria 2940328985 2940331904 131
217 iso_pr_bacteria 2940332795 2940335748 131
218 iso_pr_bacteria 2940336608 2940338014 131
219 iso_pr_bacteria 643348524 643422720 131
220 iso_pr_bacteria 8100157865 8100158746 131
221 iso_pr_bacteria 8100166142 8100169605 131
222 2225789004 2227290536 2227741459 132
223 3300000062 IMNBL1DRAFT_c0000119 IMNBL1DRAFT_000011923 132
224 3300000062 IMNBL1DRAFT_c0000355 IMNBL1DRAFT_000035518 132
225 3300000062 IMNBL1DRAFT_c0000677 IMNBL1DRAFT_000067732 132
226 3300000062 IMNBL1DRAFT_c0000682 IMNBL1DRAFT_000068222 132
227 3300000062 IMNBL1DRAFT_c0000687 IMNBL1DRAFT_000068727 132
228 3300000062 IMNBL1DRAFT_c0003450 IMNBL1DRAFT_00034505 132
229 3300000062 IMNBL1DRAFT_c0012380 IMNBL1DRAFT_00123804 132
230 3300000062 IMNBL1DRAFT_c0041101 IMNBL1DRAFT_00411011 132
231 3300000062 IMNBL1DRAFT_c0068657 IMNBL1DRAFT_00686572 132
232 3300002449 JGI24698J34947_10009875 JGI24698J34947_100098758 132
233 3300002462 JGI24702J35022_10002597 JGI24702J35022_1000259714 132
234 3300002462 JGI24702J35022_10004210 JGI24702J35022_100042101 132
235 3300002462 JGI24702J35022_10008763 JGI24702J35022_1000876312 132
236 3300002462 JGI24702J35022_10029452 JGI24702J35022_100294523 132
237 3300002462 JGI24702J35022_10227061 JGI24702J35022_102270612 132
238 3300002462 JGI24702J35022_10453175 JGI24702J35022_104531751 132
239 3300002462 JGI24702J35022_10744811 JGI24702J35022_107448111 132
240 3300002504 JGI24705J35276_12227509 JGI24705J35276_122275092 132
241 3300002509 JGI24699J35502_11133946 JGI24699J35502_1113394621 132
242 3300002509 JGI24699J35502_11134150 JGI24699J35502_1113415030 132
243 3300005071 Ga0068302_10164744 Ga0068302_101647442 132
244 3300005083 Ga0068305_10010112 Ga0068305_1001011221 132
245 3300005083 Ga0068305_10015112 Ga0068305_1001511218 132
246 3300005083 Ga0068305_10026156 Ga0068305_1002615619 132
247 3300005083 Ga0068305_10061301 Ga0068305_1006130114 132
248 3300005083 Ga0068305_10085917 Ga0068305_100859176 132
249 3300005083 Ga0068305_10103751 Ga0068305_101037511 132
250 3300005201 Ga0072941_1545031 Ga0072941_15450314 132
251 3300007106 Ga0104041_1128281 Ga0104041_11282811 132
252 3300007153 Ga0104050_1212478 Ga0104050_12124782 132
253 3300009784 Ga0123357_10040344 Ga0123357_100403441 132
254 3300009784 Ga0123357_10132820 Ga0123357_101328204 132
255 3300009784 Ga0123357_10370376 Ga0123357_103703762 132
256 3300010049 Ga0123356_10446596 Ga0123356_104465962 132
257 3300010049 Ga0123356_10882630 Ga0123356_108826302 132
258 3300010049 Ga0123356_11630111 Ga0123356_116301112 132
259 3300010049 Ga0123356_12449715 Ga0123356_124497151 132
260 3300010049 Ga0123356_12779224 Ga0123356_127792241 132
261 3300010053 Ga0134290_1112291 Ga0134290_11122911 132
262 3300010167 Ga0123353_10164495 Ga0123353_101644953 132
263 3300010167 Ga0123353_10418276 Ga0123353_104182761 132
264 3300010167 Ga0123353_10523992 Ga0123353_105239923 132
265 3300010167 Ga0123353_11213897 Ga0123353_112138972 132
266 3300010167 Ga0123353_11360614 Ga0123353_113606142 132
267 3300010882 Ga0123354_10000498 Ga0123354_1000049820 132
268 3300042602 Ga0466713_113019 Ga0466713_113019_13378_13776 132
269 3300042602 Ga0466713_121249 Ga0466713_121249_1888_2286 132
270 3300042603 Ga0466714_107938 Ga0466714_107938_1551_1949 132
271 3300042610 Ga0466698_327264 Ga0466698_327264_4827_5225 132
272 3300042612 Ga0466705_301731 Ga0466705_301731_46_444 132
273 3300042612 Ga0466705_373160 Ga0466705_373160_6183_6581 132
274 3300042615 Ga0466711_086148 Ga0466711_086148_179_577 132
275 3300042615 Ga0466711_469917 Ga0466711_469917_997_1395 132
276 3300042620 Ga0466728_421279 Ga0466728_421279_3965_4363 132
277 3300042643 Ga0466704_192770 Ga0466704_192770_1219_1617 132
278 3300042643 Ga0466704_469392 Ga0466704_469392_2085_2483 132
279 3300042649 Ga0466724_28405 Ga0466724_28405_5851_6249 132
280 3300042649 Ga0466724_53803 Ga0466724_53803_5943_6341 132
281 3300042654 Ga0466725_037990 Ga0466725_037990_6545_6943 132
282 3300042659 Ga0466733_144713 Ga0466733_144713_349_747 132
283 iso_pr_bacteria 2579779088 2582239293 132
284 iso_pr_bacteria 2590828803 2592928925 132
285 iso_pr_bacteria 2838772460 2838772781 132
286 iso_pr_bacteria 2894649344 2894650498 132
287 iso_pr_bacteria 2896321640 2896323934 132
288 iso_pr_bacteria 2896330536 2896332503 132
289 iso_pr_bacteria 2896350215 2896352315 132
290 iso_pr_bacteria 2898741527 2898744283 132
291 iso_pr_bacteria 2910930387 2910931348 132
292 3300000036 IMNBGM34_c004877 IMNBGM34_0048771 133
293 3300002504 JGI24705J35276_12219018 JGI24705J35276_122190185 133
294 3300002931 CVPL010W_10000676 CVPL010W_1000067628 133
295 3300007042 Ga0103263_101903 Ga0103263_1019034 133
296 3300007080 Ga0102735_1002384 Ga0102735_10023848 133
297 3300007085 Ga0104045_1006496 Ga0104045_10064964 133
298 3300007106 Ga0104041_1111365 Ga0104041_11113654 133
299 3300007129 Ga0102734_1006096 Ga0102734_10060963 133
300 3300007140 Ga0102740_1000340 Ga0102740_10003409 133
301 3300010049 Ga0123356_10396936 Ga0123356_103969364 133
302 3300010053 Ga0134290_1264530 Ga0134290_12645301 133
303 3300010167 Ga0123353_10000019 Ga0123353_1000001978 133
304 3300010167 Ga0123353_10003138 Ga0123353_1000313817 133
305 3300012825 Ga0160441_100482 Ga0160441_10048212 133
306 3300042592 Ga0466693_219635 Ga0466693_219635_1188_1589 133
307 3300010167 Ga0123353_12032916 Ga0123353_120329161 134
308 3300002834 JGI24696J40584_12957240 JGI24696J40584_129572405 140
309 3300042654 Ga0466725_255972 Ga0466725_255972_9507_9932 141
310 3300009784 Ga0123357_10057959 Ga0123357_100579591 142
311 3300002504 JGI24705J35276_12164918 JGI24705J35276_121649182 144
312 3300042643 Ga0466704_541626 Ga0466704_541626_807_1247 146
313 3300042613 Ga0466710_178175 Ga0466710_178175_372_845 157
314 3300042636 Ga0466703_176395 Ga0466703_176395_1924_2400 158
315 3300042654 Ga0466725_286288 Ga0466725_286288_2725_3273 182

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00410 Ribosomal_S8 Ribosomal protein S8 30 158 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.