Protein Family IF09155

Metagenome Isolate
145 Members
62 Samples
133 Scaffolds
126.79 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_134417|Ga0466703_134417_74_514
Length
146 aa
Sequence
LPAQNPEFFSSELFYTNMKRAIHSHQAPAAIGPYSQAITSGNLAPTLIALSGQLGIDPGTGNLVSGEVREQTVQALKNVEAILKEAGYSLKNVVKTTVFLADMSDFAAMNEIYAGFFTEPFPARSTVAVKSLPKNALVEIEALAFC

📊 Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.0%
Kalotermitidae 23.3%
Unclassified 15.0%
Blattidae 8.3%
Rhinotermitidae 6.7%
Termopsidae 6.7%
Passalidae 3.3%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
21 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
40 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
44 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
45 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
48 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
49 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
50 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
57 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
58 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
59 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
60 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
61 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
62 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_442212 3300042656 Bacteria 2872
2 Ga0466656_320364 3300042550 Bacteria 1917
3 Ga0466690_296955 3300042590 Bacteria 5671
4 Ga0466692_071964 3300042591 Bacteria 6544
5 Ga0466729_074336 3300042621 Bacteria 1705
6 Ga0123355_11545320 3300009826 Bacteria 644
7 Ga0123355_11797230 3300009826 Bacteria 578
8 Ga0123356_10125475 3300010049 Bacteria 2505
9 Ga0123356_10927738 3300010049 Bacteria 1042
10 Ga0466707_271472 3300042601 Bacteria 6963
11 Ga0466719_210656 3300042606 Bacteria 5364
12 Ga0466719_258185 3300042606 Unclassified 1432
13 JGI24702J35022_10020260 3300002462 Bacteria 3611
14 JGI24702J35022_10180965 3300002462 Bacteria 1197
15 Ga0466729_202993 3300042621 Bacteria 1027
16 Ga0466704_621603 3300042643 Bacteria 5207
17 Ga0466697_059948 3300042611 Bacteria 1466
18 Ga0466690_016552 3300042590 Bacteria 2031
19 Ga0466692_071441 3300042591 Bacteria 25339
20 Ga0466715_121217 3300042616 Bacteria 12685
21 Ga0466723_007158 3300042618 Bacteria 34239
22 Ga0466726_079331 3300042619 Bacteria 50907
23 Ga0466726_158387 3300042619 Bacteria 46348
24 Ga0466707_410788 3300042601 Bacteria 1262
25 Ga0466713_022356 3300042602 Bacteria 45305
26 Ga0466717_138968 3300042604 Bacteria 9339
27 Ga0466716_381475 3300042605 Bacteria 1189
28 Ga0466719_461687 3300042606 Bacteria 4723
29 Ga0466722_139249 3300042609 Bacteria 4382
30 JGI24702J35022_10016584 3300002462 Bacteria 4036
31 Ga0068305_10048374 3300005083 Bacteria 9680
32 Ga0068305_10198246 3300005083 Bacteria 1421
33 Ga0072941_1082637 3300005201 Bacteria 3120
34 Ga0072941_1109777 3300005201 Bacteria 3411
35 Ga0123357_10000126 3300009784 Bacteria 65260
36 Ga0466735_096433 3300042624 Bacteria 1918
37 Ga0466730_090952 3300042625 Bacteria 1727
38 Ga0466704_119709 3300042643 Bacteria 6486
39 Ga0466727_218918 3300042655 Bacteria 13170
40 Ga0466705_165427 3300042612 Bacteria 15405
41 Ga0466705_174966 3300042612 Bacteria 5750
42 Ga0466690_097843 3300042590 Bacteria 6399
43 Ga0466692_004981 3300042591 Bacteria 1014
44 Ga0466691_094593 3300042593 Bacteria 62434
45 Ga0466723_140192 3300042618 Bacteria 4843
46 Ga0466723_178434 3300042618 Bacteria 21543
47 Ga0466723_320062 3300042618 Bacteria 5537
48 Ga0123357_10022306 3300009784 Bacteria 8485
49 Ga0466707_288296 3300042601 Bacteria 1116
50 Ga0466707_317403 3300042601 Bacteria 1934
51 Ga0466717_312817 3300042604 Unclassified 2312
52 Ga0466722_195269 3300042609 Bacteria 5821
53 Ga0466729_240825 3300042621 Bacteria 150412
54 Ga0466735_052844 3300042624 Bacteria 2230
55 Ga0466735_063360 3300042624 Bacteria 5925
56 Ga0466704_035053 3300042643 Bacteria 6398
57 Ga0466704_370398 3300042643 Bacteria 9453
58 Ga0466691_159626 3300042593 Bacteria 1606
59 Ga0466696_303312 3300042596 Bacteria 10145
60 Ga0466715_327174 3300042616 Bacteria 10423
61 Ga0466715_433268 3300042616 Bacteria 1050
62 Ga0466718_075184 3300042617 Bacteria 2075
63 Ga0466726_097849 3300042619 Bacteria 3034
64 Ga0466728_281097 3300042620 Bacteria 12240
65 Ga0123356_11137507 3300010049 Bacteria 948
66 Ga0466701_045246 3300042598 Bacteria 23760
67 Ga0466701_088409 3300042598 Bacteria 49099
68 Ga0466700_444780 3300042600 Bacteria 8343
69 Ga0466716_411963 3300042605 Bacteria 17758
70 Ga0466697_042879 3300042611 Bacteria 1329
71 2227088872 2225789004 Unclassified 1844
72 JGI24702J35022_10033437 3300002462 Bacteria 2751
73 Ga0466735_111862 3300042624 Unclassified 1431
74 Ga0466703_090195 3300042636 Bacteria 6314
75 Ga0466727_194949 3300042655 Bacteria 20487
76 Ga0466690_228138 3300042590 Bacteria 28377
77 Ga0466690_347147 3300042590 Bacteria 1754
78 Ga0466693_414299 3300042592 Bacteria 2083
79 Ga0466696_258282 3300042596 Bacteria 2320
80 Ga0466696_297530 3300042596 Unclassified 4847
81 Ga0466711_109004 3300042615 Bacteria 7837
82 Ga0466726_037570 3300042619 Bacteria 12505
83 Ga0466726_247639 3300042619 Bacteria 1481
84 Ga0466728_270779 3300042620 Bacteria 8377
85 Ga0466713_022093 3300042602 Bacteria 13281
86 Ga0466716_285153 3300042605 Bacteria 1155
87 Ga0466735_008795 3300042624 Bacteria 1057
88 Ga0466703_151275 3300042636 Bacteria 4807
89 Ga0466704_485743 3300042643 Unclassified 15725
90 Ga0466709_320378 3300042648 Bacteria 3178
91 Ga0466725_311063 3300042654 Bacteria 6623
92 Ga0466696_481765 3300042596 Bacteria 3143
93 Ga0466711_050974 3300042615 Bacteria 16284
94 Ga0466718_157065 3300042617 Bacteria 2010
95 Ga0123357_10377344 3300009784 Bacteria 1321
96 Ga0466700_098757 3300042600 Bacteria 2881
97 Ga0466707_117321 3300042601 Bacteria 105826
98 Ga0466713_019367 3300042602 Bacteria 104354
99 Ga0466719_025382 3300042606 Bacteria 5117
100 IMNBL1DRAFT_c0001131 3300000062 Bacteria 20427
101 AustNasuHG_c1006138 3300000089 Bacteria 4295
102 Ga0068302_10148808 3300005071 Bacteria 3857
103 Ga0466703_094530 3300042636 Bacteria 3562
104 Ga0466708_004962 3300042652 Bacteria 2563
105 Ga0466705_162063 3300042612 Bacteria 1526
106 Ga0466711_093803 3300042615 Bacteria 25402
107 Ga0466723_107157 3300042618 Bacteria 20772
108 Ga0123353_11396413 3300010167 Bacteria 901
109 Ga0123354_10987850 3300010882 Bacteria 543
110 Ga0466707_009353 3300042601 Bacteria 5126
111 Ga0466722_093388 3300042609 Bacteria 5230
112 IMNBL1DRAFT_c0000063 3300000062 Bacteria 97352
113 Ga0068305_10157839 3300005083 Bacteria 4557
114 Ga0466731_154145 3300042622 Bacteria 1284
115 Ga0466735_203072 3300042624 Bacteria 3350
116 Ga0466703_290810 3300042636 Bacteria 37344
117 Ga0466709_170555 3300042648 Bacteria 7524
118 Ga0466709_285676 3300042648 Bacteria 16723
119 Ga0466727_141033 3300042655 Bacteria 10075
120 Ga0466733_044974 3300042659 Bacteria 23373
121 Ga0265387_1012358 3300024582 Bacteria 1183
122 Ga0466694_123831 3300042594 Bacteria 1587
123 Ga0466696_356451 3300042596 Bacteria 11421
124 Ga0466711_398758 3300042615 Bacteria 47200
125 Ga0466726_236415 3300042619 Bacteria 3186
126 Ga0466706_112921 3300042599 Bacteria 7805
127 Ga0466707_033666 3300042601 Bacteria 5087
128 JGI24702J35022_10002727 3300002462 Bacteria 10707
129 JGI24702J35022_10024232 3300002462 Bacteria 3279
130 JGI24699J35502_11134014 3300002509 Bacteria 24334
131 Ga0466703_134417 3300042636 Bacteria 1080
132 Ga0466703_391162 3300042636 Bacteria 15224
133 Ga0466727_217068 3300042655 Bacteria 4907

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_093388 Ga0466722_093388_4371_4730 119
2 3300010167 Ga0123353_11396413 Ga0123353_113964132 123
3 3300042591 Ga0466692_004981 Ga0466692_004981_65_439 124
4 3300042593 Ga0466691_159626 Ga0466691_159626_1185_1559 124
5 3300042598 Ga0466701_045246 Ga0466701_045246_10204_10578 124
6 3300042606 Ga0466719_461687 Ga0466719_461687_2540_2914 124
7 3300042617 Ga0466718_157065 Ga0466718_157065_833_1207 124
8 3300042619 Ga0466726_158387 Ga0466726_158387_44837_45211 124
9 3300042621 Ga0466729_202993 Ga0466729_202993_188_562 124
10 3300042624 Ga0466735_063360 Ga0466735_063360_287_661 124
11 3300042624 Ga0466735_096433 Ga0466735_096433_538_912 124
12 3300042656 Ga0466732_442212 Ga0466732_442212_178_552 124
13 iso_pr_bacteria 2820348946 2820349973 124
14 3300000089 AustNasuHG_c1006138 AustNasuHG_10061382 125
15 3300005083 Ga0068305_10198246 Ga0068305_101982462 125
16 3300024582 Ga0265387_1012358 Ga0265387_10123582 125
17 3300042590 Ga0466690_016552 Ga0466690_016552_1057_1434 125
18 3300042590 Ga0466690_097843 Ga0466690_097843_2130_2507 125
19 3300042590 Ga0466690_228138 Ga0466690_228138_9149_9526 125
20 3300042593 Ga0466691_094593 Ga0466691_094593_25503_25880 125
21 3300042594 Ga0466694_123831 Ga0466694_123831_1127_1504 125
22 3300042596 Ga0466696_258282 Ga0466696_258282_657_1034 125
23 3300042601 Ga0466707_033666 Ga0466707_033666_1878_2255 125
24 3300042601 Ga0466707_410788 Ga0466707_410788_251_628 125
25 3300042602 Ga0466713_019367 Ga0466713_019367_47734_48111 125
26 3300042604 Ga0466717_138968 Ga0466717_138968_3655_4032 125
27 3300042609 Ga0466722_139249 Ga0466722_139249_935_1312 125
28 3300042609 Ga0466722_195269 Ga0466722_195269_4762_5139 125
29 3300042612 Ga0466705_165427 Ga0466705_165427_7979_8356 125
30 3300042615 Ga0466711_093803 Ga0466711_093803_16143_16520 125
31 3300042616 Ga0466715_327174 Ga0466715_327174_6517_6894 125
32 3300042616 Ga0466715_433268 Ga0466715_433268_428_805 125
33 3300042618 Ga0466723_007158 Ga0466723_007158_18245_18622 125
34 3300042619 Ga0466726_079331 Ga0466726_079331_4631_5008 125
35 3300042619 Ga0466726_236415 Ga0466726_236415_524_901 125
36 3300042620 Ga0466728_281097 Ga0466728_281097_9989_10366 125
37 3300042621 Ga0466729_074336 Ga0466729_074336_1171_1548 125
38 3300042622 Ga0466731_154145 Ga0466731_154145_382_759 125
39 3300042624 Ga0466735_111862 Ga0466735_111862_41_418 125
40 3300042624 Ga0466735_203072 Ga0466735_203072_1469_1846 125
41 3300042636 Ga0466703_094530 Ga0466703_094530_2387_2764 125
42 3300042643 Ga0466704_370398 Ga0466704_370398_2880_3257 125
43 3300042648 Ga0466709_170555 Ga0466709_170555_4725_5102 125
44 3300042648 Ga0466709_320378 Ga0466709_320378_753_1130 125
45 3300042655 Ga0466727_217068 Ga0466727_217068_3643_4020 125
46 3300042655 Ga0466727_218918 Ga0466727_218918_7517_7894 125
47 3300042659 Ga0466733_044974 Ga0466733_044974_19557_19934 125
48 iso_pr_bacteria 2820778767 2820780851 125
49 iso_pr_bacteria 2940195863 2940197865 125
50 iso_pr_bacteria 2940199050 2940200437 125
51 iso_pr_bacteria 2940209341 2940211756 125
52 iso_pr_bacteria 2940346213 2940347348 125
53 3300002462 JGI24702J35022_10016584 JGI24702J35022_100165842 126
54 3300002462 JGI24702J35022_10033437 JGI24702J35022_100334372 126
55 3300005083 Ga0068305_10157839 Ga0068305_101578392 126
56 3300005201 Ga0072941_1082637 Ga0072941_10826373 126
57 3300005201 Ga0072941_1109777 Ga0072941_11097772 126
58 3300009826 Ga0123355_11797230 Ga0123355_117972302 126
59 3300010049 Ga0123356_10927738 Ga0123356_109277382 126
60 3300010049 Ga0123356_11137507 Ga0123356_111375072 126
61 3300042550 Ga0466656_320364 Ga0466656_320364_888_1268 126
62 3300042590 Ga0466690_347147 Ga0466690_347147_1260_1640 126
63 3300042591 Ga0466692_071441 Ga0466692_071441_9277_9657 126
64 3300042591 Ga0466692_071964 Ga0466692_071964_6146_6526 126
65 3300042596 Ga0466696_303312 Ga0466696_303312_5162_5542 126
66 3300042598 Ga0466701_088409 Ga0466701_088409_21747_22127 126
67 3300042600 Ga0466700_444780 Ga0466700_444780_4321_4701 126
68 3300042601 Ga0466707_271472 Ga0466707_271472_1852_2232 126
69 3300042605 Ga0466716_381475 Ga0466716_381475_767_1147 126
70 3300042606 Ga0466719_025382 Ga0466719_025382_1976_2356 126
71 3300042606 Ga0466719_210656 Ga0466719_210656_1709_2089 126
72 3300042611 Ga0466697_042879 Ga0466697_042879_649_1029 126
73 3300042611 Ga0466697_059948 Ga0466697_059948_388_768 126
74 3300042615 Ga0466711_050974 Ga0466711_050974_4648_5028 126
75 3300042615 Ga0466711_109004 Ga0466711_109004_2810_3190 126
76 3300042615 Ga0466711_398758 Ga0466711_398758_37598_37978 126
77 3300042617 Ga0466718_075184 Ga0466718_075184_1008_1388 126
78 3300042618 Ga0466723_140192 Ga0466723_140192_2269_2649 126
79 3300042619 Ga0466726_037570 Ga0466726_037570_11434_11814 126
80 3300042619 Ga0466726_097849 Ga0466726_097849_298_678 126
81 3300042619 Ga0466726_247639 Ga0466726_247639_179_559 126
82 3300042620 Ga0466728_270779 Ga0466728_270779_3144_3524 126
83 3300042636 Ga0466703_090195 Ga0466703_090195_296_676 126
84 3300042636 Ga0466703_151275 Ga0466703_151275_63_443 126
85 3300042655 Ga0466727_194949 Ga0466727_194949_8303_8683 126
86 iso_pr_bacteria 2820155744 2820156282 126
87 iso_pr_bacteria 2820762746 2820763782 126
88 iso_pr_bacteria 2940216256 2940216324 126
89 3300000062 IMNBL1DRAFT_c0000063 IMNBL1DRAFT_000006373 127
90 3300002462 JGI24702J35022_10002727 JGI24702J35022_100027276 127
91 3300002509 JGI24699J35502_11134014 JGI24699J35502_111340149 127
92 3300005071 Ga0068302_10148808 Ga0068302_101488083 127
93 3300009784 Ga0123357_10022306 Ga0123357_100223065 127
94 3300009826 Ga0123355_11545320 Ga0123355_115453202 127
95 3300010049 Ga0123356_10125475 Ga0123356_101254752 127
96 3300010882 Ga0123354_10987850 Ga0123354_109878501 127
97 3300042600 Ga0466700_098757 Ga0466700_098757_1503_1886 127
98 3300042605 Ga0466716_285153 Ga0466716_285153_98_481 127
99 3300042612 Ga0466705_174966 Ga0466705_174966_5205_5588 127
100 3300042616 Ga0466715_121217 Ga0466715_121217_8513_8896 127
101 3300042618 Ga0466723_320062 Ga0466723_320062_1293_1676 127
102 3300042625 Ga0466730_090952 Ga0466730_090952_1017_1400 127
103 3300042636 Ga0466703_391162 Ga0466703_391162_11767_12150 127
104 3300042643 Ga0466704_485743 Ga0466704_485743_8115_8498 127
105 3300042652 Ga0466708_004962 Ga0466708_004962_1840_2223 127
106 3300042654 Ga0466725_311063 Ga0466725_311063_1740_2123 127
107 2225789004 2227088872 2227466844 128
108 3300002462 JGI24702J35022_10180965 JGI24702J35022_101809651 128
109 3300042590 Ga0466690_296955 Ga0466690_296955_1480_1866 128
110 3300042592 Ga0466693_414299 Ga0466693_414299_369_755 128
111 3300042596 Ga0466696_356451 Ga0466696_356451_1181_1567 128
112 3300042599 Ga0466706_112921 Ga0466706_112921_6783_7169 128
113 3300042601 Ga0466707_009353 Ga0466707_009353_2993_3379 128
114 3300042601 Ga0466707_288296 Ga0466707_288296_565_951 128
115 3300042604 Ga0466717_312817 Ga0466717_312817_527_913 128
116 3300042612 Ga0466705_162063 Ga0466705_162063_896_1282 128
117 3300042621 Ga0466729_240825 Ga0466729_240825_87024_87410 128
118 3300042624 Ga0466735_008795 Ga0466735_008795_317_703 128
119 3300042624 Ga0466735_052844 Ga0466735_052844_1399_1785 128
120 3300042643 Ga0466704_035053 Ga0466704_035053_5932_6318 128
121 3300042643 Ga0466704_621603 Ga0466704_621603_3847_4233 128
122 iso_pr_bacteria 2508501043 2508700647 128
123 iso_pr_bacteria 2820123897 2820126304 128
124 iso_pr_bacteria 650716099 650878914 128
125 3300009784 Ga0123357_10000126 Ga0123357_1000012615 129
126 3300042596 Ga0466696_297530 Ga0466696_297530_170_559 129
127 3300042596 Ga0466696_481765 Ga0466696_481765_170_559 129
128 3300042606 Ga0466719_258185 Ga0466719_258185_682_1071 129
129 3300042618 Ga0466723_107157 Ga0466723_107157_11881_12270 129
130 3300042618 Ga0466723_178434 Ga0466723_178434_20247_20636 129
131 3300042643 Ga0466704_119709 Ga0466704_119709_2434_2823 129
132 3300042655 Ga0466727_141033 Ga0466727_141033_8969_9358 129
133 3300002462 JGI24702J35022_10020260 JGI24702J35022_100202602 130
134 3300002462 JGI24702J35022_10024232 JGI24702J35022_100242324 130
135 3300009784 Ga0123357_10377344 Ga0123357_103773442 130
136 3300042602 Ga0466713_022356 Ga0466713_022356_19442_19834 130
137 3300005083 Ga0068305_10048374 Ga0068305_1004837412 131
138 3300042601 Ga0466707_117321 Ga0466707_117321_90311_90736 131
139 3300042636 Ga0466703_290810 Ga0466703_290810_27720_28115 131
140 3300000062 IMNBL1DRAFT_c0001131 IMNBL1DRAFT_00011316 134
141 3300042601 Ga0466707_317403 Ga0466707_317403_677_1084 135
142 3300042602 Ga0466713_022093 Ga0466713_022093_587_997 136
143 3300042605 Ga0466716_411963 Ga0466716_411963_17133_17558 141
144 3300042648 Ga0466709_285676 Ga0466709_285676_4228_4653 141
145 3300042636 Ga0466703_134417 Ga0466703_134417_74_514 146

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 26 145 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.