Protein Family IF09140
Metagenome
Isolate
145
Members
50
Samples
138
Scaffolds
196.68
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_100612|Ga0466703_100612_34051_34719
- Length
- 222 aa
- Sequence
- MIQVSVFVYTFFSLFGKLAGMTATKRNPGERIAELCKTYSISRETLAERSGLDPELIRRIEEEEHIPDLAPLLKISRALGVRLGTLLDDHEELGPVITRKGQASDTARFITGNPADGSRAAGSGSRDAAGKGHYFHALAADKGSRHMEPFIVDMEHDEDQPKSSHEGEEFIYILEGTIKVEYGKDSYTVNTGDSIYYDSIVPHRVFSSGGAARILAVIYTPA
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.2%
Kalotermitidae
27.1%
Blattidae
12.5%
Termopsidae
8.3%
Passalidae
6.2%
Unclassified
6.2%
Rhinotermitidae
6.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
12
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 6 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 18 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 41 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_286942 | 3300042612 | Bacteria | 1338 |
| 2 | Ga0466733_106142 | 3300042659 | Bacteria | 10504 |
| 3 | Ga0123353_10622555 | 3300010167 | Bacteria | 1536 |
| 4 | Ga0466703_100612 | 3300042636 | Bacteria | 66039 |
| 5 | Ga0466704_167651 | 3300042643 | Bacteria | 19990 |
| 6 | Ga0466708_021806 | 3300042652 | Bacteria | 4204 |
| 7 | Ga0265387_1034017 | 3300024582 | Bacteria | 841 |
| 8 | Ga0265387_1072108 | 3300024582 | Bacteria | 668 |
| 9 | Ga0466690_002240 | 3300042590 | Bacteria | 6015 |
| 10 | Ga0466692_047488 | 3300042591 | Bacteria | 2578 |
| 11 | Ga0466716_240294 | 3300042605 | Bacteria | 4955 |
| 12 | 2227466015 | 2225789004 | Archaea | 5155 |
| 13 | Ga0466733_044201 | 3300042659 | Bacteria | 54685 |
| 14 | Ga0466703_047869 | 3300042636 | Bacteria | 58815 |
| 15 | Ga0466709_186893 | 3300042648 | Bacteria | 9141 |
| 16 | Ga0466727_324338 | 3300042655 | Bacteria | 3804 |
| 17 | Ga0466718_030714 | 3300042617 | Bacteria | 8515 |
| 18 | Ga0466718_050537 | 3300042617 | Bacteria | 8628 |
| 19 | Ga0466723_269121 | 3300042618 | Bacteria | 8345 |
| 20 | Ga0466699_206045 | 3300042597 | Bacteria | 8454 |
| 21 | Ga0466706_281851 | 3300042599 | Bacteria | 2335 |
| 22 | Ga0466719_312720 | 3300042606 | Bacteria | 2092 |
| 23 | Ga0466722_216757 | 3300042609 | Bacteria | 8578 |
| 24 | 2227656846 | 2225789004 | Archaea | 1969 |
| 25 | JGI24698J34947_10000025 | 3300002449 | Bacteria | 40185 |
| 26 | Ga0466697_111395 | 3300042611 | Bacteria | 3482 |
| 27 | Ga0466733_076886 | 3300042659 | Bacteria | 33267 |
| 28 | Ga0466733_162813 | 3300042659 | Bacteria | 1577 |
| 29 | Ga0123356_10807400 | 3300010049 | Archaea | 1109 |
| 30 | Ga0466729_217235 | 3300042621 | Bacteria | 1040 |
| 31 | Ga0466702_321330 | 3300042635 | Bacteria | 1019 |
| 32 | Ga0466704_225547 | 3300042643 | Bacteria | 39919 |
| 33 | Ga0466727_024830 | 3300042655 | Bacteria | 3287 |
| 34 | Ga0466711_048821 | 3300042615 | Bacteria | 11804 |
| 35 | Ga0466711_401048 | 3300042615 | Bacteria | 13916 |
| 36 | Ga0466718_015162 | 3300042617 | Bacteria | 17755 |
| 37 | Ga0466718_056848 | 3300042617 | Bacteria | 7626 |
| 38 | Ga0466723_149634 | 3300042618 | Bacteria | 3269 |
| 39 | Ga0466723_227236 | 3300042618 | Bacteria | 5030 |
| 40 | Ga0264413_133694 | 3300024493 | Bacteria | 2679 |
| 41 | Ga0466690_238003 | 3300042590 | Bacteria | 1152 |
| 42 | Ga0466692_108833 | 3300042591 | Bacteria | 2305 |
| 43 | Ga0466696_121016 | 3300042596 | Bacteria | 24238 |
| 44 | Ga0466699_441353 | 3300042597 | Bacteria | 2202 |
| 45 | Ga0466707_020194 | 3300042601 | Bacteria | 1922 |
| 46 | Ga0466713_011773 | 3300042602 | Bacteria | 8481 |
| 47 | Ga0466719_050147 | 3300042606 | Bacteria | 5295 |
| 48 | Ga0466733_020164 | 3300042659 | Bacteria | 2682 |
| 49 | Ga0466733_130267 | 3300042659 | Bacteria | 5604 |
| 50 | Ga0123353_10862867 | 3300010167 | Bacteria | 1239 |
| 51 | Ga0466729_300417 | 3300042621 | Unclassified | 1345 |
| 52 | Ga0466735_057905 | 3300042624 | Archaea | 1383 |
| 53 | Ga0466735_169917 | 3300042624 | Bacteria | 1840 |
| 54 | Ga0466704_314205 | 3300042643 | Bacteria | 42787 |
| 55 | Ga0466708_086496 | 3300042652 | Bacteria | 18578 |
| 56 | Ga0466727_301806 | 3300042655 | Unclassified | 2661 |
| 57 | Ga0466718_120628 | 3300042617 | Bacteria | 7534 |
| 58 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 59 | Ga0466716_435585 | 3300042605 | Bacteria | 3070 |
| 60 | Ga0466719_180350 | 3300042606 | Bacteria | 1013 |
| 61 | Ga0466719_202607 | 3300042606 | Bacteria | 14142 |
| 62 | Ga0466719_375632 | 3300042606 | Bacteria | 1215 |
| 63 | 2227072463 | 2225789003 | Unclassified | 11894 |
| 64 | 2227464924 | 2225789004 | Archaea | 5225 |
| 65 | IMNBL1DRAFT_c0026270 | 3300000062 | Archaea | 2215 |
| 66 | Ga0072940_1025660 | 3300005200 | Bacteria | 4894 |
| 67 | Ga0466735_117606 | 3300042624 | Bacteria | 1022 |
| 68 | Ga0466703_370479 | 3300042636 | Bacteria | 72306 |
| 69 | Ga0466711_022336 | 3300042615 | Bacteria | 5104 |
| 70 | Ga0466715_081309 | 3300042616 | Bacteria | 9125 |
| 71 | Ga0466726_003819 | 3300042619 | Bacteria | 7168 |
| 72 | Ga0466726_451779 | 3300042619 | Bacteria | 4195 |
| 73 | Ga0466692_106435 | 3300042591 | Bacteria | 2872 |
| 74 | Ga0466692_153632 | 3300042591 | Bacteria | 1250 |
| 75 | Ga0466691_034599 | 3300042593 | Bacteria | 5461 |
| 76 | Ga0466696_078835 | 3300042596 | Bacteria | 21700 |
| 77 | Ga0466696_089381 | 3300042596 | Bacteria | 2994 |
| 78 | Ga0466706_014198 | 3300042599 | Bacteria | 2036 |
| 79 | Ga0466722_214612 | 3300042609 | Bacteria | 1172 |
| 80 | Ga0068302_10136747 | 3300005071 | Bacteria | 2126 |
| 81 | Ga0123356_10182293 | 3300010049 | Bacteria | 2123 |
| 82 | Ga0123353_10036960 | 3300010167 | Bacteria | 7655 |
| 83 | Ga0123353_11191313 | 3300010167 | Bacteria | 1001 |
| 84 | Ga0466702_400421 | 3300042635 | Bacteria | 1605 |
| 85 | Ga0466704_289720 | 3300042643 | Bacteria | 2673 |
| 86 | Ga0466715_312719 | 3300042616 | Bacteria | 5641 |
| 87 | Ga0466726_012234 | 3300042619 | Unclassified | 1165 |
| 88 | Ga0466729_057120 | 3300042621 | Bacteria | 37274 |
| 89 | Ga0466692_077788 | 3300042591 | Bacteria | 2632 |
| 90 | Ga0466692_170279 | 3300042591 | Bacteria | 12828 |
| 91 | Ga0466691_193609 | 3300042593 | Bacteria | 3491 |
| 92 | Ga0466699_231283 | 3300042597 | Bacteria | 3477 |
| 93 | Ga0466706_078188 | 3300042599 | Bacteria | 1490 |
| 94 | Ga0466707_223064 | 3300042601 | Bacteria | 1143 |
| 95 | Ga0466707_273854 | 3300042601 | Bacteria | 1544 |
| 96 | Ga0466713_049104 | 3300042602 | Bacteria | 2039 |
| 97 | Ga0466714_122244 | 3300042603 | Bacteria | 1054 |
| 98 | Ga0466733_123192 | 3300042659 | Archaea | 34981 |
| 99 | Ga0123353_10000188 | 3300010167 | Archaea | 78260 |
| 100 | Ga0466708_315749 | 3300042652 | Bacteria | 28028 |
| 101 | Ga0466727_212494 | 3300042655 | Bacteria | 13739 |
| 102 | Ga0466727_233850 | 3300042655 | Bacteria | 2502 |
| 103 | Ga0466723_287759 | 3300042618 | Bacteria | 52406 |
| 104 | Ga0466726_413173 | 3300042619 | Bacteria | 1920 |
| 105 | Ga0466726_458492 | 3300042619 | Unclassified | 1631 |
| 106 | Ga0415639_112510 | 3300038395 | Bacteria | 1670 |
| 107 | Ga0466699_157424 | 3300042597 | Bacteria | 1557 |
| 108 | Ga0466701_101364 | 3300042598 | Bacteria | 1386 |
| 109 | Ga0466707_049794 | 3300042601 | Bacteria | 3051 |
| 110 | Ga0466707_129077 | 3300042601 | Bacteria | 2725 |
| 111 | Ga0466707_354635 | 3300042601 | Bacteria | 1165 |
| 112 | Ga0466713_145001 | 3300042602 | Unclassified | 1941 |
| 113 | Ga0466716_207710 | 3300042605 | Bacteria | 35454 |
| 114 | IMNBL1DRAFT_c0138185 | 3300000062 | Bacteria | 631 |
| 115 | JGI24702J35022_10112104 | 3300002462 | Archaea | 1500 |
| 116 | Ga0466733_064984 | 3300042659 | Bacteria | 6097 |
| 117 | Ga0466733_164040 | 3300042659 | Bacteria | 19007 |
| 118 | Ga0123355_10175115 | 3300009826 | Unclassified | 3197 |
| 119 | Ga0123356_10239949 | 3300010049 | Unclassified | 1883 |
| 120 | Ga0123356_10568734 | 3300010049 | Bacteria | 1296 |
| 121 | Ga0466735_020465 | 3300042624 | Bacteria | 2001 |
| 122 | Ga0466702_313041 | 3300042635 | Bacteria | 9190 |
| 123 | Ga0466703_357755 | 3300042636 | Bacteria | 20094 |
| 124 | Ga0466708_134260 | 3300042652 | Bacteria | 1796 |
| 125 | Ga0466708_238189 | 3300042652 | Bacteria | 7805 |
| 126 | Ga0466727_013981 | 3300042655 | Archaea | 1620 |
| 127 | Ga0466715_048251 | 3300042616 | Bacteria | 81213 |
| 128 | Ga0466729_175152 | 3300042621 | Bacteria | 1163 |
| 129 | Ga0466692_177329 | 3300042591 | Bacteria | 3972 |
| 130 | Ga0466699_411785 | 3300042597 | Bacteria | 2765 |
| 131 | Ga0466707_174725 | 3300042601 | Bacteria | 2962 |
| 132 | Ga0466707_346259 | 3300042601 | Unclassified | 1170 |
| 133 | Ga0466719_144976 | 3300042606 | Bacteria | 13137 |
| 134 | Ga0466719_284667 | 3300042606 | Bacteria | 1409 |
| 135 | Ga0466722_058686 | 3300042609 | Bacteria | 14294 |
| 136 | Ga0466722_185517 | 3300042609 | Bacteria | 15757 |
| 137 | IMNBL1DRAFT_c0006737 | 3300000062 | Archaea | 6215 |
| 138 | IMNBL1DRAFT_c0047584 | 3300000062 | Unclassified | 1383 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042618 | Ga0466723_269121 | Ga0466723_269121_6881_7471 | 178 |
| 2 | 3300038395 | Ga0415639_112510 | Ga0415639_112510_590_1132 | 180 |
| 3 | 3300042602 | Ga0466713_011773 | Ga0466713_011773_6851_7402 | 183 |
| 4 | 3300042615 | Ga0466711_401048 | Ga0466711_401048_4459_5013 | 184 |
| 5 | 3300042599 | Ga0466706_281851 | Ga0466706_281851_1027_1584 | 185 |
| 6 | 3300042624 | Ga0466735_057905 | Ga0466735_057905_92_655 | 187 |
| 7 | 3300042601 | Ga0466707_174725 | Ga0466707_174725_1421_1987 | 188 |
| 8 | 3300042655 | Ga0466727_324338 | Ga0466727_324338_1673_2239 | 188 |
| 9 | 3300042609 | Ga0466722_058686 | Ga0466722_058686_1988_2557 | 189 |
| 10 | 3300042619 | Ga0466726_003819 | Ga0466726_003819_808_1377 | 189 |
| 11 | 3300042636 | Ga0466703_370479 | Ga0466703_370479_7799_8368 | 189 |
| 12 | 2225789003 | 2227072463 | 2227435450 | 190 |
| 13 | 2225789004 | 2227464924 | 2227902355 | 190 |
| 14 | 2225789004 | 2227466015 | 2227904713 | 190 |
| 15 | 2225789004 | 2227656846 | 2228255351 | 190 |
| 16 | 3300042602 | Ga0466713_049104 | Ga0466713_049104_1327_1899 | 190 |
| 17 | 3300042619 | Ga0466726_458492 | Ga0466726_458492_415_987 | 190 |
| 18 | 3300042655 | Ga0466727_024830 | Ga0466727_024830_531_1103 | 190 |
| 19 | 3300042655 | Ga0466727_301806 | Ga0466727_301806_1475_2047 | 190 |
| 20 | 3300000062 | IMNBL1DRAFT_c0006737 | IMNBL1DRAFT_00067374 | 191 |
| 21 | 3300000062 | IMNBL1DRAFT_c0026270 | IMNBL1DRAFT_00262702 | 191 |
| 22 | 3300000062 | IMNBL1DRAFT_c0047584 | IMNBL1DRAFT_00475842 | 191 |
| 23 | 3300000062 | IMNBL1DRAFT_c0138185 | IMNBL1DRAFT_01381851 | 191 |
| 24 | 3300002462 | JGI24702J35022_10112104 | JGI24702J35022_101121042 | 191 |
| 25 | 3300042601 | Ga0466707_273854 | Ga0466707_273854_730_1329 | 191 |
| 26 | 3300042611 | Ga0466697_111395 | Ga0466697_111395_1982_2557 | 191 |
| 27 | 3300042659 | Ga0466733_123192 | Ga0466733_123192_1470_2045 | 191 |
| 28 | iso_pu_archaea | 2773857682 | 2774154213 | 191 |
| 29 | 3300009826 | Ga0123355_10175115 | Ga0123355_101751154 | 192 |
| 30 | 3300010049 | Ga0123356_10239949 | Ga0123356_102399492 | 192 |
| 31 | 3300010049 | Ga0123356_10807400 | Ga0123356_108074001 | 192 |
| 32 | 3300010167 | Ga0123353_10000188 | Ga0123353_1000018854 | 192 |
| 33 | 3300042601 | Ga0466707_223064 | Ga0466707_223064_368_988 | 192 |
| 34 | 3300042609 | Ga0466722_185517 | Ga0466722_185517_9528_10106 | 192 |
| 35 | 3300042609 | Ga0466722_216757 | Ga0466722_216757_3661_4239 | 192 |
| 36 | 3300042621 | Ga0466729_057120 | Ga0466729_057120_12895_13473 | 192 |
| 37 | 3300042624 | Ga0466735_169917 | Ga0466735_169917_74_652 | 192 |
| 38 | 3300042643 | Ga0466704_314205 | Ga0466704_314205_33649_34227 | 192 |
| 39 | 3300010167 | Ga0123353_10622555 | Ga0123353_106225552 | 193 |
| 40 | 3300042615 | Ga0466711_022336 | Ga0466711_022336_1691_2272 | 193 |
| 41 | 3300042617 | Ga0466718_015162 | Ga0466718_015162_12545_13126 | 193 |
| 42 | 3300042617 | Ga0466718_030714 | Ga0466718_030714_2135_2716 | 193 |
| 43 | 3300042617 | Ga0466718_050537 | Ga0466718_050537_2288_2869 | 193 |
| 44 | 3300042652 | Ga0466708_238189 | Ga0466708_238189_6103_6684 | 193 |
| 45 | 3300005071 | Ga0068302_10136747 | Ga0068302_101367472 | 194 |
| 46 | 3300005200 | Ga0072940_1025660 | Ga0072940_10256603 | 194 |
| 47 | 3300010049 | Ga0123356_10182293 | Ga0123356_101822932 | 194 |
| 48 | 3300010049 | Ga0123356_10568734 | Ga0123356_105687343 | 194 |
| 49 | 3300010167 | Ga0123353_10036960 | Ga0123353_100369605 | 194 |
| 50 | 3300024582 | Ga0265387_1034017 | Ga0265387_10340172 | 194 |
| 51 | 3300024582 | Ga0265387_1072108 | Ga0265387_10721081 | 194 |
| 52 | 3300042597 | Ga0466699_206045 | Ga0466699_206045_4663_5247 | 194 |
| 53 | 3300042597 | Ga0466699_231283 | Ga0466699_231283_1463_2047 | 194 |
| 54 | 3300042597 | Ga0466699_411785 | Ga0466699_411785_161_745 | 194 |
| 55 | 3300042597 | Ga0466699_441353 | Ga0466699_441353_1443_2027 | 194 |
| 56 | 3300042598 | Ga0466701_101364 | Ga0466701_101364_784_1368 | 194 |
| 57 | 3300042601 | Ga0466707_129077 | Ga0466707_129077_837_1421 | 194 |
| 58 | 3300042602 | Ga0466713_145001 | Ga0466713_145001_1184_1768 | 194 |
| 59 | 3300042603 | Ga0466714_122244 | Ga0466714_122244_321_905 | 194 |
| 60 | 3300042635 | Ga0466702_321330 | Ga0466702_321330_373_957 | 194 |
| 61 | 3300042635 | Ga0466702_400421 | Ga0466702_400421_323_907 | 194 |
| 62 | 3300042655 | Ga0466727_212494 | Ga0466727_212494_10192_10776 | 194 |
| 63 | 3300042659 | Ga0466733_076886 | Ga0466733_076886_30691_31275 | 194 |
| 64 | iso_pr_bacteria | 2923982719 | 2923983103 | 194 |
| 65 | iso_pr_bacteria | 2940195863 | 2940197224 | 194 |
| 66 | iso_pr_bacteria | 2940199050 | 2940199784 | 194 |
| 67 | iso_pr_bacteria | 2940209341 | 2940210130 | 194 |
| 68 | iso_pr_bacteria | 2940346213 | 2940348815 | 194 |
| 69 | iso_pr_bacteria | 2940371297 | 2940373301 | 194 |
| 70 | 3300002449 | JGI24698J34947_10000025 | JGI24698J34947_100000253 | 195 |
| 71 | 3300010167 | Ga0123353_11191313 | Ga0123353_111913132 | 195 |
| 72 | 3300042606 | Ga0466719_312720 | Ga0466719_312720_1241_1828 | 195 |
| 73 | 3300042612 | Ga0466705_286942 | Ga0466705_286942_121_708 | 195 |
| 74 | 3300042615 | Ga0466711_048821 | Ga0466711_048821_304_891 | 195 |
| 75 | 3300042624 | Ga0466735_020465 | Ga0466735_020465_1402_1989 | 195 |
| 76 | 3300042635 | Ga0466702_313041 | Ga0466702_313041_7386_7973 | 195 |
| 77 | 3300042659 | Ga0466733_020164 | Ga0466733_020164_1952_2539 | 195 |
| 78 | 3300042659 | Ga0466733_064984 | Ga0466733_064984_3640_4227 | 195 |
| 79 | 3300042659 | Ga0466733_106142 | Ga0466733_106142_6723_7310 | 195 |
| 80 | 3300042659 | Ga0466733_130267 | Ga0466733_130267_108_695 | 195 |
| 81 | 3300042659 | Ga0466733_162813 | Ga0466733_162813_165_752 | 195 |
| 82 | 3300042659 | Ga0466733_164040 | Ga0466733_164040_8191_8778 | 195 |
| 83 | 3300042616 | Ga0466715_312719 | Ga0466715_312719_828_1418 | 196 |
| 84 | 3300042618 | Ga0466723_227236 | Ga0466723_227236_3599_4240 | 196 |
| 85 | 3300042619 | Ga0466726_451779 | Ga0466726_451779_116_706 | 196 |
| 86 | 3300042636 | Ga0466703_357755 | Ga0466703_357755_5863_6453 | 196 |
| 87 | 3300042648 | Ga0466709_186893 | Ga0466709_186893_4667_5257 | 196 |
| 88 | 3300042652 | Ga0466708_315749 | Ga0466708_315749_8082_8672 | 196 |
| 89 | 3300042591 | Ga0466692_077788 | Ga0466692_077788_459_1052 | 197 |
| 90 | 3300042591 | Ga0466692_153632 | Ga0466692_153632_197_790 | 197 |
| 91 | 3300042591 | Ga0466692_170279 | Ga0466692_170279_9567_10160 | 197 |
| 92 | 3300042596 | Ga0466696_078835 | Ga0466696_078835_3728_4321 | 197 |
| 93 | 3300042601 | Ga0466707_020194 | Ga0466707_020194_766_1359 | 197 |
| 94 | 3300042621 | Ga0466729_217235 | Ga0466729_217235_434_1027 | 197 |
| 95 | 3300042621 | Ga0466729_300417 | Ga0466729_300417_223_816 | 197 |
| 96 | 3300024493 | Ga0264413_133694 | Ga0264413_1336943 | 198 |
| 97 | 3300042591 | Ga0466692_108833 | Ga0466692_108833_1590_2186 | 198 |
| 98 | 3300042599 | Ga0466706_078188 | Ga0466706_078188_434_1030 | 198 |
| 99 | 3300042617 | Ga0466718_120628 | Ga0466718_120628_1539_2135 | 198 |
| 100 | 3300042619 | Ga0466726_413173 | Ga0466726_413173_710_1306 | 198 |
| 101 | 3300042655 | Ga0466727_233850 | Ga0466727_233850_1038_1634 | 198 |
| 102 | 3300042597 | Ga0466699_157424 | Ga0466699_157424_763_1362 | 199 |
| 103 | 3300042609 | Ga0466722_214612 | Ga0466722_214612_379_978 | 199 |
| 104 | 3300042618 | Ga0466723_287759 | Ga0466723_287759_36698_37297 | 199 |
| 105 | 3300042624 | Ga0466735_117606 | Ga0466735_117606_231_830 | 199 |
| 106 | 3300042652 | Ga0466708_134260 | Ga0466708_134260_768_1367 | 199 |
| 107 | 3300042659 | Ga0466733_044201 | Ga0466733_044201_27747_28346 | 199 |
| 108 | 3300042590 | Ga0466690_002240 | Ga0466690_002240_1926_2528 | 200 |
| 109 | 3300042590 | Ga0466690_238003 | Ga0466690_238003_352_954 | 200 |
| 110 | 3300042591 | Ga0466692_106435 | Ga0466692_106435_49_669 | 200 |
| 111 | 3300042595 | Ga0466695_259092 | Ga0466695_259092_81013_81615 | 200 |
| 112 | 3300042606 | Ga0466719_180350 | Ga0466719_180350_239_841 | 200 |
| 113 | 3300042606 | Ga0466719_202607 | Ga0466719_202607_662_1264 | 200 |
| 114 | 3300042618 | Ga0466723_149634 | Ga0466723_149634_474_1076 | 200 |
| 115 | 3300042643 | Ga0466704_225547 | Ga0466704_225547_9090_9692 | 200 |
| 116 | 3300042655 | Ga0466727_013981 | Ga0466727_013981_215_817 | 200 |
| 117 | 3300042601 | Ga0466707_049794 | Ga0466707_049794_204_809 | 201 |
| 118 | 3300042616 | Ga0466715_081309 | Ga0466715_081309_915_1520 | 201 |
| 119 | 3300042617 | Ga0466718_056848 | Ga0466718_056848_1200_1805 | 201 |
| 120 | 3300042601 | Ga0466707_354635 | Ga0466707_354635_381_989 | 202 |
| 121 | 3300042606 | Ga0466719_375632 | Ga0466719_375632_321_929 | 202 |
| 122 | 3300042616 | Ga0466715_048251 | Ga0466715_048251_43382_43990 | 202 |
| 123 | 3300042652 | Ga0466708_086496 | Ga0466708_086496_5020_5628 | 202 |
| 124 | 3300010167 | Ga0123353_10862867 | Ga0123353_108628672 | 203 |
| 125 | 3300042599 | Ga0466706_014198 | Ga0466706_014198_900_1511 | 203 |
| 126 | 3300042605 | Ga0466716_240294 | Ga0466716_240294_3802_4416 | 204 |
| 127 | 3300042643 | Ga0466704_289720 | Ga0466704_289720_426_1040 | 204 |
| 128 | 3300042591 | Ga0466692_177329 | Ga0466692_177329_1628_2245 | 205 |
| 129 | 3300042606 | Ga0466719_284667 | Ga0466719_284667_538_1155 | 205 |
| 130 | 3300042591 | Ga0466692_047488 | Ga0466692_047488_567_1187 | 206 |
| 131 | 3300042596 | Ga0466696_089381 | Ga0466696_089381_713_1333 | 206 |
| 132 | 3300042619 | Ga0466726_012234 | Ga0466726_012234_313_999 | 206 |
| 133 | 3300042652 | Ga0466708_021806 | Ga0466708_021806_1397_2017 | 206 |
| 134 | 3300042596 | Ga0466696_121016 | Ga0466696_121016_18467_19090 | 207 |
| 135 | 3300042643 | Ga0466704_167651 | Ga0466704_167651_12476_13099 | 207 |
| 136 | 3300042606 | Ga0466719_144976 | Ga0466719_144976_8135_8770 | 211 |
| 137 | 3300042605 | Ga0466716_207710 | Ga0466716_207710_6819_7457 | 212 |
| 138 | 3300042593 | Ga0466691_193609 | Ga0466691_193609_1627_2268 | 213 |
| 139 | 3300042621 | Ga0466729_175152 | Ga0466729_175152_292_942 | 216 |
| 140 | 3300042593 | Ga0466691_034599 | Ga0466691_034599_2807_3460 | 217 |
| 141 | 3300042606 | Ga0466719_050147 | Ga0466719_050147_1527_2180 | 217 |
| 142 | 3300042605 | Ga0466716_435585 | Ga0466716_435585_1176_1835 | 219 |
| 143 | 3300042601 | Ga0466707_346259 | Ga0466707_346259_436_1098 | 220 |
| 144 | 3300042636 | Ga0466703_047869 | Ga0466703_047869_23096_23758 | 220 |
| 145 | 3300042636 | Ga0466703_100612 | Ga0466703_100612_34051_34719 | 222 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.62 | 0.71 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.