Protein Family IF09139

Metagenome Isolate
186 Members
68 Samples
162 Scaffolds
203.68 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_098605|Ga0466703_098605_6064_6765
Length
233 aa
Sequence
MKCEQLTENSNQKKLPGTFIEVLVIKNNNMKIIAVGMNYADHNKELQNTLLTEEPVIFMKSDSALLKDGKPFFLPDFSSEIHYETEVVIRINKLGKNIAGQFAHRYYSEVTVGIDFTARDLQRSLRQRGLPWEICKGFDQSAVIGDFVPLSEIGQVQNIDFSLEIDERCVQRDNTSNMLFTVDEIIAYVSRFFTLKIGDLIFTGTPSGVGEVQTGNHLKGYIGNKKLLDFYVR

📊 Sample Types

Isolate 12.9%
Metagenome 87.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.8%
Termitidae 24.2%
Kalotermitidae 19.7%
Unclassified 7.6%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 3.0%
Drosophilidae 3.0%
Elmidae 3.0%
Hodotermitidae 1.5%
Cambaridae 1.5%
Daphniidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
11 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
12 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
13 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
14 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
15 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
19 2923982719 Parabacteroides sp. 52 Isolate Blattidae
20 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
21 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
22 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
35 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
36 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
37 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
38 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
46 2904728850 Flavobacterium sp. xlx-214 Isolate
47 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
48 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
49 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
56 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
57 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
58 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
59 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
63 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
66 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
67 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
68 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_101505 3300042659 Bacteria 3676
2 Ga0466707_016891 3300042601 Bacteria 35922
3 Ga0466716_390504 3300042605 Bacteria 5665
4 Ga0466719_043916 3300042606 Bacteria 13096
5 Ga0123357_10092520 3300009784 Bacteria 3934
6 Ga0123354_10058861 3300010882 Bacteria 5704
7 Ga0466711_194370 3300042615 Bacteria 1084
8 Ga0466715_138304 3300042616 Bacteria 7514
9 Ga0466726_423872 3300042619 Bacteria 2193
10 Ga0466693_336039 3300042592 Bacteria 2339
11 Ga0466709_095978 3300042648 Bacteria 34809
12 Ga0466727_101745 3300042655 Bacteria 2139
13 2227524342 2225789004 Bacteria 3277
14 JGI24696J40584_12842128 3300002834 Bacteria 957
15 Ga0466705_301331 3300042612 Bacteria 7209
16 Ga0466707_312347 3300042601 Bacteria 2770
17 Ga0466698_488051 3300042610 Bacteria 2021
18 Ga0123357_10036470 3300009784 Bacteria 6691
19 Ga0123353_10521325 3300010167 Bacteria 1724
20 Ga0466710_341213 3300042613 Bacteria 2517
21 Ga0466715_150159 3300042616 Bacteria 4816
22 Ga0466726_142845 3300042619 Bacteria 1364
23 Ga0466690_038698 3300042590 Bacteria 19777
24 Ga0466735_051290 3300042624 Bacteria 3660
25 Ga0466703_075697 3300042636 Bacteria 9217
26 2227280803 2225789004 Bacteria 6812
27 Ga0068305_10372723 3300005083 Bacteria 1134
28 Ga0466706_264957 3300042599 Bacteria 2690
29 Ga0466707_180224 3300042601 Bacteria 1292
30 Ga0466713_070253 3300042602 Bacteria 4805
31 Ga0466697_012774 3300042611 Bacteria 1420
32 Ga0123357_10006254 3300009784 Bacteria 14468
33 Ga0123354_10001986 3300010882 Bacteria 26232
34 Ga0466715_149950 3300042616 Bacteria 4801
35 Ga0466715_583205 3300042616 Bacteria 24186
36 Ga0466729_063676 3300042621 Bacteria 2168
37 Ga0466690_246577 3300042590 Bacteria 16883
38 Ga0466690_381813 3300042590 Bacteria 66142
39 Ga0466691_148747 3300042593 Bacteria 15449
40 Ga0466695_340885 3300042595 Bacteria 2868
41 Ga0466735_103703 3300042624 Bacteria 8863
42 Ga0466735_233659 3300042624 Bacteria 1540
43 Ga0466725_151340 3300042654 Bacteria 1517
44 Ga0074306_1122697 3300005309 Bacteria 914
45 Ga0466705_113440 3300042612 Bacteria 2972
46 Ga0466705_117307 3300042612 Bacteria 31530
47 Ga0466733_178171 3300042659 Bacteria 1859
48 Ga0466733_190063 3300042659 Bacteria 4972
49 Ga0466706_029313 3300042599 Bacteria 3370
50 Ga0466713_117267 3300042602 Bacteria 44157
51 Ga0466714_115350 3300042603 Bacteria 92077
52 Ga0466717_216363 3300042604 Bacteria 5368
53 Ga0123355_11240080 3300009826 Bacteria 756
54 Ga0123353_10060382 3300010167 Bacteria 6080
55 Ga0123353_10111340 3300010167 Bacteria 4409
56 Ga0123353_10935848 3300010167 Bacteria 1174
57 Ga0123353_11396259 3300010167 Bacteria 901
58 Ga0123354_10234880 3300010882 Unclassified 1905
59 Ga0466711_081869 3300042615 Bacteria 19763
60 Ga0466715_484239 3300042616 Bacteria 11010
61 Ga0466726_068286 3300042619 Bacteria 7520
62 Ga0466729_060358 3300042621 Bacteria 13859
63 Ga0466690_145016 3300042590 Bacteria 9974
64 Ga0466691_187837 3300042593 Bacteria 10413
65 Ga0466696_071660 3300042596 Bacteria 2928
66 Ga0466735_022154 3300042624 Bacteria 5257
67 Ga0466703_098605 3300042636 Bacteria 6901
68 Ga0068305_10007404 3300005083 Bacteria 89340
69 Ga0104045_1026129 3300007085 Bacteria 7628
70 Ga0466733_055799 3300042659 Bacteria 106016
71 Ga0466706_093477 3300042599 Bacteria 5278
72 Ga0466707_189353 3300042601 Bacteria 19637
73 Ga0466707_336627 3300042601 Bacteria 2618
74 Ga0466716_041216 3300042605 Bacteria 5636
75 Ga0466722_005250 3300042609 Bacteria 14032
76 Ga0123353_10465929 3300010167 Bacteria 1855
77 Ga0123354_10100820 3300010882 Bacteria 3905
78 Ga0466711_443745 3300042615 Bacteria 25021
79 Ga0466715_399077 3300042616 Bacteria 1891
80 Ga0466692_123809 3300042591 Bacteria 14245
81 Ga0466696_004662 3300042596 Bacteria 3206
82 Ga0466696_097884 3300042596 Bacteria 16155
83 Ga0466696_359997 3300042596 Bacteria 6409
84 Ga0466704_055817 3300042643 Bacteria 8022
85 Ga0466704_251609 3300042643 Bacteria 45182
86 Ga0466704_492381 3300042643 Bacteria 59499
87 Ga0466709_013032 3300042648 Bacteria 7245
88 Ga0466709_067104 3300042648 Bacteria 2016
89 Ga0466708_464448 3300042652 Bacteria 8345
90 JGI24702J35022_10000743 3300002462 Bacteria 20084
91 Ga0466697_206778 3300042611 Bacteria 1925
92 Ga0466706_146517 3300042599 Bacteria 2134
93 Ga0466713_039564 3300042602 Bacteria 1131
94 Ga0466714_117493 3300042603 Bacteria 34193
95 Ga0466716_429759 3300042605 Bacteria 21627
96 Ga0466722_022507 3300042609 Bacteria 12182
97 Ga0123356_10364193 3300010049 Unclassified 1574
98 Ga0123356_12022056 3300010049 Bacteria 719
99 Ga0466711_033752 3300042615 Bacteria 1642
100 Ga0466715_018721 3300042616 Bacteria 59480
101 Ga0466715_040385 3300042616 Bacteria 43736
102 Ga0466715_337503 3300042616 Bacteria 17152
103 Ga0466723_031578 3300042618 Bacteria 25603
104 Ga0466693_033042 3300042592 Bacteria 1044
105 Ga0466735_171342 3300042624 Bacteria 6348
106 Ga0466704_388648 3300042643 Bacteria 5957
107 IMNBL1DRAFT_c0001719 3300000062 Bacteria 16090
108 JGI24702J35022_10008385 3300002462 Bacteria 5851
109 Ga0068305_10025910 3300005083 Unclassified 13178
110 Ga0072941_1497435 3300005201 Bacteria 2624
111 Ga0104045_1002981 3300007085 Bacteria 11834
112 Ga0466705_005241 3300042612 Bacteria 8467
113 Ga0466733_049115 3300042659 Bacteria 2509
114 Ga0466733_078806 3300042659 Bacteria 7143
115 Ga0466706_025086 3300042599 Bacteria 7138
116 Ga0466706_029973 3300042599 Bacteria 5825
117 Ga0466706_156630 3300042599 Bacteria 44167
118 Ga0466707_265281 3300042601 Bacteria 5744
119 Ga0466713_060620 3300042602 Bacteria 398690
120 Ga0466722_084512 3300042609 Bacteria 5041
121 Ga0123357_10229642 3300009784 Bacteria 2037
122 Ga0123353_10110619 3300010167 Bacteria 4426
123 Ga0123353_11767695 3300010167 Bacteria 770
124 Ga0123354_10008354 3300010882 Bacteria 15731
125 Ga0123354_10024967 3300010882 Bacteria 9423
126 Ga0466710_270337 3300042613 Bacteria 1164
127 Ga0466711_279775 3300042615 Unclassified 1030
128 Ga0466726_032938 3300042619 Bacteria 39699
129 Ga0466693_269711 3300042592 Bacteria 2094
130 Ga0466691_060692 3300042593 Bacteria 22870
131 Ga0466735_000409 3300042624 Bacteria 5125
132 Ga0466703_202757 3300042636 Bacteria 8523
133 Ga0466703_233949 3300042636 Bacteria 12778
134 Ga0466704_106814 3300042643 Bacteria 18291
135 Ga0466727_124195 3300042655 Bacteria 107642
136 2227101657 2225789004 Bacteria 1788
137 2227261351 2225789004 Bacteria 7006
138 IMNBL1DRAFT_c0019925 3300000062 Bacteria 2731
139 Ga0068305_10063851 3300005083 Bacteria 9032
140 Ga0466705_143850 3300042612 Bacteria 38978
141 Ga0466707_149202 3300042601 Bacteria 9070
142 Ga0466713_056151 3300042602 Bacteria 40882
143 Ga0466719_302570 3300042606 Bacteria 1001
144 Ga0466722_087839 3300042609 Bacteria 11186
145 Ga0123353_10680395 3300010167 Bacteria 1449
146 Ga0123354_10063593 3300010882 Bacteria 5421
147 Ga0123354_10108823 3300010882 Bacteria 3677
148 Ga0466705_404261 3300042612 Bacteria 34067
149 Ga0466711_033361 3300042615 Bacteria 49617
150 Ga0466711_068572 3300042615 Bacteria 1342
151 Ga0466690_172738 3300042590 Bacteria 57212
152 Ga0466696_323500 3300042596 Bacteria 24747
153 Ga0466729_285797 3300042621 Bacteria 17692
154 Ga0466703_150283 3300042636 Bacteria 2603
155 Ga0466709_064196 3300042648 Bacteria 3277
156 Ga0466727_289381 3300042655 Bacteria 2156
157 IMNBL1DRAFT_c0005949 3300000062 Bacteria 6822
158 IMNBL1DRAFT_c0016532 3300000062 Bacteria 3154
159 IMNBL1DRAFT_c0026187 3300000062 Bacteria 2221
160 JGI24702J35022_10023808 3300002462 Bacteria 3310
161 Ga0068305_10142123 3300005083 Bacteria 2953
162 Ga0123357_10000910 3300009784 Bacteria 30052

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_265281 Ga0466707_265281_2179_2796 185
2 3300042615 Ga0466711_279775 Ga0466711_279775_34_594 186
3 3300042611 Ga0466697_206778 Ga0466697_206778_1167_1784 187
4 3300042621 Ga0466729_285797 Ga0466729_285797_15976_16545 189
5 3300042636 Ga0466703_150283 Ga0466703_150283_1586_2155 189
6 3300042648 Ga0466709_095978 Ga0466709_095978_25392_26009 193
7 3300042655 Ga0466727_101745 Ga0466727_101745_637_1251 193
8 3300042603 Ga0466714_115350 Ga0466714_115350_40633_41223 196
9 3300042612 Ga0466705_404261 Ga0466705_404261_4207_4797 196
10 3300002834 JGI24696J40584_12842128 JGI24696J40584_128421281 197
11 3300010049 Ga0123356_12022056 Ga0123356_120220561 197
12 3300042612 Ga0466705_117307 Ga0466705_117307_17712_18305 197
13 3300000062 IMNBL1DRAFT_c0001719 IMNBL1DRAFT_000171914 198
14 3300042599 Ga0466706_146517 Ga0466706_146517_1513_2109 198
15 3300042611 Ga0466697_012774 Ga0466697_012774_14_610 198
16 3300042616 Ga0466715_149950 Ga0466715_149950_1846_2442 198
17 3300042616 Ga0466715_150159 Ga0466715_150159_1843_2439 198
18 3300042619 Ga0466726_142845 Ga0466726_142845_488_1084 198
19 3300005083 Ga0068305_10142123 Ga0068305_101421232 199
20 3300009784 Ga0123357_10036470 Ga0123357_100364705 199
21 3300042601 Ga0466707_180224 Ga0466707_180224_565_1164 199
22 3300010882 Ga0123354_10024967 Ga0123354_100249676 200
23 3300042590 Ga0466690_381813 Ga0466690_381813_52867_53469 200
24 2225789004 2227261351 2227707582 202
25 3300042606 Ga0466719_302570 Ga0466719_302570_117_725 202
26 3300042609 Ga0466722_084512 Ga0466722_084512_2511_3119 202
27 3300042615 Ga0466711_033752 Ga0466711_033752_675_1283 202
28 3300042615 Ga0466711_068572 Ga0466711_068572_46_654 202
29 3300042615 Ga0466711_194370 Ga0466711_194370_46_654 202
30 3300042615 Ga0466711_443745 Ga0466711_443745_24034_24642 202
31 3300042616 Ga0466715_018721 Ga0466715_018721_2189_2797 202
32 3300042619 Ga0466726_068286 Ga0466726_068286_1329_1937 202
33 2225789004 2227101657 2227485439 203
34 3300005201 Ga0072941_1497435 Ga0072941_14974351 203
35 3300042590 Ga0466690_145016 Ga0466690_145016_5848_6459 203
36 3300042592 Ga0466693_033042 Ga0466693_033042_407_1018 203
37 3300042593 Ga0466691_187837 Ga0466691_187837_660_1271 203
38 3300042595 Ga0466695_340885 Ga0466695_340885_1385_1996 203
39 3300042596 Ga0466696_359997 Ga0466696_359997_1508_2119 203
40 3300042601 Ga0466707_336627 Ga0466707_336627_1710_2321 203
41 3300042602 Ga0466713_117267 Ga0466713_117267_5155_5766 203
42 3300042604 Ga0466717_216363 Ga0466717_216363_2964_3575 203
43 3300042613 Ga0466710_270337 Ga0466710_270337_38_649 203
44 3300042615 Ga0466711_081869 Ga0466711_081869_1215_1826 203
45 3300042616 Ga0466715_138304 Ga0466715_138304_22_633 203
46 3300042616 Ga0466715_484239 Ga0466715_484239_447_1058 203
47 3300042616 Ga0466715_583205 Ga0466715_583205_5442_6053 203
48 3300042621 Ga0466729_063676 Ga0466729_063676_494_1105 203
49 3300042624 Ga0466735_051290 Ga0466735_051290_1511_2122 203
50 3300042636 Ga0466703_075697 Ga0466703_075697_7766_8377 203
51 3300042643 Ga0466704_492381 Ga0466704_492381_53785_54396 203
52 3300042652 Ga0466708_464448 Ga0466708_464448_7677_8288 203
53 3300042654 Ga0466725_151340 Ga0466725_151340_126_737 203
54 3300042659 Ga0466733_055799 Ga0466733_055799_52698_53309 203
55 3300042659 Ga0466733_190063 Ga0466733_190063_1599_2210 203
56 iso_pr_bacteria 2811995047 2812946422 203
57 iso_pr_bacteria 2864878056 2864879540 203
58 iso_pr_bacteria 2864886855 2864888341 203
59 iso_pr_bacteria 2904728850 2904729870 203
60 iso_pr_bacteria 2958471994 2958472675 203
61 2225789004 2227280803 2227732669 204
62 3300000062 IMNBL1DRAFT_c0016532 IMNBL1DRAFT_00165323 204
63 3300002462 JGI24702J35022_10023808 JGI24702J35022_100238084 204
64 3300005083 Ga0068305_10025910 Ga0068305_1002591012 204
65 3300005083 Ga0068305_10063851 Ga0068305_100638513 204
66 3300007085 Ga0104045_1002981 Ga0104045_100298110 204
67 3300009826 Ga0123355_11240080 Ga0123355_112400802 204
68 3300010049 Ga0123356_10364193 Ga0123356_103641933 204
69 3300010167 Ga0123353_10060382 Ga0123353_100603823 204
70 3300010167 Ga0123353_10110619 Ga0123353_101106194 204
71 3300010167 Ga0123353_10111340 Ga0123353_101113404 204
72 3300010167 Ga0123353_10465929 Ga0123353_104659292 204
73 3300010167 Ga0123353_10521325 Ga0123353_105213251 204
74 3300010167 Ga0123353_10680395 Ga0123353_106803952 204
75 3300010167 Ga0123353_10935848 Ga0123353_109358482 204
76 3300010167 Ga0123353_11396259 Ga0123353_113962591 204
77 3300010167 Ga0123353_11767695 Ga0123353_117676951 204
78 3300010882 Ga0123354_10108823 Ga0123354_101088232 204
79 3300010882 Ga0123354_10234880 Ga0123354_102348803 204
80 3300042590 Ga0466690_038698 Ga0466690_038698_10306_10920 204
81 3300042590 Ga0466690_172738 Ga0466690_172738_18231_18845 204
82 3300042590 Ga0466690_246577 Ga0466690_246577_4034_4648 204
83 3300042592 Ga0466693_269711 Ga0466693_269711_481_1095 204
84 3300042592 Ga0466693_336039 Ga0466693_336039_554_1168 204
85 3300042593 Ga0466691_060692 Ga0466691_060692_9182_9796 204
86 3300042593 Ga0466691_148747 Ga0466691_148747_4336_4950 204
87 3300042596 Ga0466696_071660 Ga0466696_071660_860_1474 204
88 3300042596 Ga0466696_097884 Ga0466696_097884_10649_11263 204
89 3300042596 Ga0466696_323500 Ga0466696_323500_11852_12466 204
90 3300042603 Ga0466714_117493 Ga0466714_117493_29781_30395 204
91 3300042605 Ga0466716_041216 Ga0466716_041216_3734_4348 204
92 3300042605 Ga0466716_390504 Ga0466716_390504_4511_5125 204
93 3300042605 Ga0466716_429759 Ga0466716_429759_9018_9632 204
94 3300042612 Ga0466705_005241 Ga0466705_005241_6035_6649 204
95 3300042612 Ga0466705_143850 Ga0466705_143850_30396_31010 204
96 3300042616 Ga0466715_040385 Ga0466715_040385_32011_32625 204
97 3300042616 Ga0466715_337503 Ga0466715_337503_5538_6152 204
98 3300042616 Ga0466715_399077 Ga0466715_399077_1166_1780 204
99 3300042618 Ga0466723_031578 Ga0466723_031578_7521_8135 204
100 3300042621 Ga0466729_060358 Ga0466729_060358_1960_2574 204
101 3300042624 Ga0466735_022154 Ga0466735_022154_3016_3630 204
102 3300042624 Ga0466735_233659 Ga0466735_233659_736_1350 204
103 3300042636 Ga0466703_202757 Ga0466703_202757_3954_4568 204
104 3300042643 Ga0466704_055817 Ga0466704_055817_6332_6946 204
105 3300042643 Ga0466704_106814 Ga0466704_106814_6247_6861 204
106 3300042643 Ga0466704_251609 Ga0466704_251609_6954_7568 204
107 3300042643 Ga0466704_388648 Ga0466704_388648_65_679 204
108 3300042648 Ga0466709_064196 Ga0466709_064196_1118_1732 204
109 3300042648 Ga0466709_067104 Ga0466709_067104_1146_1760 204
110 3300042659 Ga0466733_078806 Ga0466733_078806_210_824 204
111 3300042659 Ga0466733_178171 Ga0466733_178171_575_1189 204
112 iso_pr_bacteria 2820757377 2820759213 204
113 iso_pr_bacteria 2923982719 2923983339 204
114 iso_pr_bacteria 2940195863 2940197160 204
115 iso_pr_bacteria 2940202316 2940203770 204
116 iso_pr_bacteria 2940205530 2940209140 204
117 iso_pr_bacteria 2940212447 2940216078 204
118 iso_pr_bacteria 2940298504 2940302132 204
119 iso_pr_bacteria 2940302308 2940305910 204
120 iso_pr_bacteria 2940306115 2940309782 204
121 iso_pr_bacteria 2940309933 2940313567 204
122 iso_pr_bacteria 2940313741 2940317409 204
123 iso_pr_bacteria 2940317558 2940321246 204
124 iso_pr_bacteria 2940321370 2940325059 204
125 iso_pr_bacteria 2940325180 2940328780 204
126 iso_pr_bacteria 2940328985 2940332613 204
127 iso_pr_bacteria 2940332795 2940336460 204
128 iso_pr_bacteria 2940371297 2940372635 204
129 2225789004 2227524342 2228030536 205
130 3300000062 IMNBL1DRAFT_c0019925 IMNBL1DRAFT_00199252 205
131 3300002462 JGI24702J35022_10008385 JGI24702J35022_100083854 205
132 3300042591 Ga0466692_123809 Ga0466692_123809_5643_6260 205
133 3300042596 Ga0466696_004662 Ga0466696_004662_1839_2456 205
134 3300042599 Ga0466706_025086 Ga0466706_025086_561_1178 205
135 3300042599 Ga0466706_029973 Ga0466706_029973_4376_4993 205
136 3300042599 Ga0466706_156630 Ga0466706_156630_39473_40090 205
137 3300042599 Ga0466706_264957 Ga0466706_264957_1379_1996 205
138 3300042601 Ga0466707_149202 Ga0466707_149202_310_927 205
139 3300042601 Ga0466707_189353 Ga0466707_189353_3806_4423 205
140 3300042601 Ga0466707_312347 Ga0466707_312347_78_695 205
141 3300042602 Ga0466713_056151 Ga0466713_056151_6564_7181 205
142 3300042606 Ga0466719_043916 Ga0466719_043916_3730_4347 205
143 3300042609 Ga0466722_005250 Ga0466722_005250_8576_9193 205
144 3300042609 Ga0466722_022507 Ga0466722_022507_4791_5408 205
145 3300042609 Ga0466722_087839 Ga0466722_087839_6709_7326 205
146 3300042610 Ga0466698_488051 Ga0466698_488051_1334_1951 205
147 3300042612 Ga0466705_301331 Ga0466705_301331_5865_6482 205
148 3300042613 Ga0466710_341213 Ga0466710_341213_652_1269 205
149 3300042615 Ga0466711_033361 Ga0466711_033361_18712_19329 205
150 3300042619 Ga0466726_423872 Ga0466726_423872_775_1392 205
151 3300042624 Ga0466735_000409 Ga0466735_000409_191_808 205
152 3300042624 Ga0466735_103703 Ga0466735_103703_4389_5006 205
153 3300042624 Ga0466735_171342 Ga0466735_171342_2454_3071 205
154 3300042636 Ga0466703_233949 Ga0466703_233949_5838_6455 205
155 3300042648 Ga0466709_013032 Ga0466709_013032_5380_5997 205
156 3300042655 Ga0466727_289381 Ga0466727_289381_1393_2010 205
157 3300042659 Ga0466733_101505 Ga0466733_101505_1258_1875 205
158 iso_pr_bacteria 2820778767 2820779632 205
159 3300000062 IMNBL1DRAFT_c0005949 IMNBL1DRAFT_00059495 206
160 3300000062 IMNBL1DRAFT_c0026187 IMNBL1DRAFT_00261872 206
161 3300002462 JGI24702J35022_10000743 JGI24702J35022_100007435 206
162 3300005083 Ga0068305_10007404 Ga0068305_1000740456 206
163 3300005083 Ga0068305_10372723 Ga0068305_103727232 206
164 3300009784 Ga0123357_10000910 Ga0123357_100009104 206
165 3300009784 Ga0123357_10092520 Ga0123357_100925202 206
166 3300009784 Ga0123357_10229642 Ga0123357_102296422 206
167 3300010882 Ga0123354_10001986 Ga0123354_1000198610 206
168 3300010882 Ga0123354_10058861 Ga0123354_100588612 206
169 3300010882 Ga0123354_10063593 Ga0123354_100635936 206
170 3300010882 Ga0123354_10100820 Ga0123354_101008203 206
171 3300042601 Ga0466707_016891 Ga0466707_016891_20470_21090 206
172 3300005309 Ga0074306_1122697 Ga0074306_11226972 207
173 3300042602 Ga0466713_039564 Ga0466713_039564_236_859 207
174 3300042602 Ga0466713_070253 Ga0466713_070253_2446_3069 207
175 3300042612 Ga0466705_113440 Ga0466705_113440_1420_2043 207
176 3300042599 Ga0466706_029313 Ga0466706_029313_2457_3083 208
177 3300042599 Ga0466706_093477 Ga0466706_093477_1962_2588 208
178 3300042602 Ga0466713_060620 Ga0466713_060620_381939_382565 208
179 iso_pr_bacteria 2910959314 2910962240 209
180 3300009784 Ga0123357_10006254 Ga0123357_100062548 210
181 3300010882 Ga0123354_10008354 Ga0123354_100083543 210
182 3300042655 Ga0466727_124195 Ga0466727_124195_106828_107460 210
183 3300007085 Ga0104045_1026129 Ga0104045_102612913 220
184 3300042659 Ga0466733_049115 Ga0466733_049115_14_688 224
185 3300042619 Ga0466726_032938 Ga0466726_032938_19989_20666 225
186 3300042636 Ga0466703_098605 Ga0466703_098605_6064_6765 233

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family 31 215 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01557 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.