Protein Family IF09122

Metagenome Isolate
158 Members
41 Samples
154 Scaffolds
265.12 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_065803|Ga0466703_065803_7132_7998
Length
288 aa
Sequence
MNIALIGYGKMGRILERTALERGHRVAAVVDPFVSGFPTGSGAPLYTTIAEWTRLSGAGNSAEGGVDVAVEFTRPDTAVENIRALIEGGIPTVAGTTGWYDHLKEIETLAGEKKGSFCWSSNYSLGVNLFYRIAAFAAKLSDPFPEYDVGGWEFHHNKKIDSPSGTAKILVEKILAVMTRKKKAVWEKLNRPPAPDELHFPSLRLGSIPGVHAVCFDSPSDTIEITHTGRSRDGLALGAIRAAEWLVNCPGPGKSAGSARSGVFTIDDVMEDILKAAVLPLTGFAAER

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.9%
Kalotermitidae 35.9%
Unclassified 12.8%
Rhinotermitidae 7.7%
Termopsidae 7.7%

🌳 Taxonomy

Archaea 1
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 650716102 Treponema primitia ZAS-2 Isolate Unclassified
2 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10013022 3300010049 Bacteria 8047
2 Ga0466703_232321 3300042636 Bacteria 6019
3 Ga0466704_232614 3300042643 Bacteria 2322
4 Ga0466708_109511 3300042652 Bacteria 32313
5 Ga0466708_464475 3300042652 Bacteria 69222
6 Ga0466712_081472 3300042614 Bacteria 9937
7 Ga0466712_204971 3300042614 Bacteria 1740
8 Ga0466715_098690 3300042616 Bacteria 13525
9 Ga0466715_260123 3300042616 Bacteria 6541
10 Ga0466723_006517 3300042618 Bacteria 14855
11 Ga0466723_096020 3300042618 Bacteria 11191
12 Ga0466728_049517 3300042620 Bacteria 2814
13 Ga0466707_261228 3300042601 Bacteria 1109
14 Ga0466707_279247 3300042601 Bacteria 3144
15 Ga0466719_096424 3300042606 Bacteria 2228
16 Ga0466720_009999 3300042607 Unclassified 10463
17 Ga0466720_011873 3300042607 Bacteria 1073
18 Ga0466720_186658 3300042607 Bacteria 1754
19 Ga0466720_233106 3300042607 Bacteria 42880
20 Ga0466722_211545 3300042609 Bacteria 2743
21 Ga0072941_1010098 3300005201 Bacteria 12642
22 Ga0264413_115566 3300024493 Bacteria 11298
23 Ga0466691_005002 3300042593 Bacteria 2350
24 Ga0466691_025299 3300042593 Bacteria 2691
25 Ga0466691_120345 3300042593 Bacteria 13092
26 Ga0466696_082242 3300042596 Bacteria 11475
27 Ga0466705_046514 3300042612 Bacteria 4407
28 Ga0466732_339863 3300042656 Bacteria 3834
29 Ga0466703_053982 3300042636 Bacteria 35406
30 Ga0466709_140248 3300042648 Bacteria 7448
31 Ga0466708_023393 3300042652 Bacteria 3961
32 Ga0466715_086582 3300042616 Bacteria 6630
33 Ga0466715_174577 3300042616 Bacteria 2974
34 Ga0466715_270970 3300042616 Bacteria 3036
35 Ga0466728_078215 3300042620 Bacteria 4596
36 Ga0466716_066787 3300042605 Bacteria 4976
37 Ga0466716_247787 3300042605 Bacteria 10104
38 Ga0466720_040240 3300042607 Bacteria 13976
39 AustNasuHG_c1000196 3300000089 Bacteria 19966
40 JGI24698J34947_10066139 3300002449 Bacteria 1759
41 Ga0072941_1005893 3300005201 Bacteria 13274
42 Ga0466705_108985 3300042612 Bacteria 1066
43 Ga0466705_138823 3300042612 Bacteria 3705
44 Ga0466709_412505 3300042648 Bacteria 1792
45 Ga0466727_069864 3300042655 Bacteria 1900
46 Ga0466705_488971 3300042612 Bacteria 7617
47 Ga0466712_153651 3300042614 Bacteria 1918
48 Ga0466712_246164 3300042614 Bacteria 1105
49 Ga0466723_304311 3300042618 Bacteria 3892
50 Ga0466726_469940 3300042619 Bacteria 3157
51 Ga0466728_063252 3300042620 Bacteria 5206
52 Ga0466700_299947 3300042600 Bacteria 2477
53 Ga0466707_176047 3300042601 Bacteria 1631
54 Ga0466720_023154 3300042607 Bacteria 31720
55 Ga0466720_069212 3300042607 Bacteria 9347
56 Ga0466720_149801 3300042607 Bacteria 12041
57 Ga0466720_153295 3300042607 Bacteria 2950
58 Ga0466720_218634 3300042607 Bacteria 1144
59 JGI24698J34947_10057290 3300002449 Bacteria 1934
60 Ga0264413_122423 3300024493 Bacteria 10407
61 Ga0466690_152887 3300042590 Bacteria 11754
62 Ga0466729_307080 3300042621 Bacteria 1770
63 Ga0466735_198670 3300042624 Bacteria 1399
64 Ga0466703_065803 3300042636 Bacteria 8199
65 Ga0466709_075030 3300042648 Bacteria 18734
66 Ga0466709_101846 3300042648 Bacteria 4145
67 Ga0466708_077544 3300042652 Bacteria 7996
68 Ga0466708_389577 3300042652 Bacteria 54586
69 Ga0466727_149806 3300042655 Bacteria 3399
70 Ga0466715_357417 3300042616 Bacteria 1057
71 Ga0466718_103258 3300042617 Bacteria 5595
72 Ga0466723_155358 3300042618 Bacteria 3217
73 Ga0466723_160805 3300042618 Bacteria 4966
74 Ga0466723_196144 3300042618 Bacteria 3170
75 Ga0466723_298435 3300042618 Bacteria 4343
76 Ga0466707_365356 3300042601 Bacteria 1771
77 Ga0466716_439008 3300042605 Bacteria 5531
78 Ga0466719_390155 3300042606 Bacteria 1311
79 Ga0466720_077344 3300042607 Bacteria 10091
80 JGI24698J34947_10029868 3300002449 Bacteria 2877
81 Ga0456237_0016775 3300041968 Unclassified 1031
82 Ga0466699_061473 3300042597 Bacteria 1422
83 Ga0466699_291512 3300042597 Archaea 1286
84 Ga0466705_349749 3300042612 Unclassified 4780
85 Ga0123356_10000406 3300010049 Bacteria 48995
86 Ga0466704_209487 3300042643 Bacteria 45601
87 Ga0466704_341458 3300042643 Bacteria 9781
88 Ga0466723_105383 3300042618 Bacteria 2799
89 Ga0466707_341621 3300042601 Bacteria 1173
90 Ga0466719_331483 3300042606 Bacteria 2190
91 Ga0466720_006499 3300042607 Bacteria 7160
92 JGI24698J34947_10017715 3300002449 Bacteria 3857
93 JGI24695J34938_10007095 3300002450 Bacteria 6622
94 Ga0264413_106803 3300024493 Bacteria 9303
95 Ga0466691_014861 3300042593 Bacteria 3481
96 Ga0466694_203898 3300042594 Bacteria 15560
97 Ga0466696_143907 3300042596 Bacteria 1086
98 Ga0466696_210894 3300042596 Bacteria 3802
99 Ga0466699_079848 3300042597 Bacteria 2599
100 Ga0123355_10020536 3300009826 Bacteria 10553
101 Ga0466731_299879 3300042622 Bacteria 1501
102 Ga0466704_221950 3300042643 Bacteria 12708
103 Ga0466704_248035 3300042643 Bacteria 1290
104 Ga0466709_259608 3300042648 Bacteria 8752
105 Ga0466708_013013 3300042652 Bacteria 5360
106 Ga0466712_082466 3300042614 Bacteria 1229
107 Ga0466715_154919 3300042616 Bacteria 14311
108 Ga0466723_088657 3300042618 Bacteria 4001
109 Ga0466723_194702 3300042618 Bacteria 2682
110 Ga0466720_117641 3300042607 Bacteria 10871
111 JGI24698J34947_10002680 3300002449 Bacteria 9605
112 JGI24698J34947_10015927 3300002449 Bacteria 4088
113 JGI24698J34947_10051724 3300002449 Bacteria 2064
114 JGI24695J34938_10005531 3300002450 Bacteria 7846
115 Ga0466690_042215 3300042590 Bacteria 4853
116 Ga0466690_401174 3300042590 Bacteria 1137
117 Ga0466691_116209 3300042593 Bacteria 16837
118 Ga0466705_038488 3300042612 Bacteria 5264
119 Ga0123353_10941268 3300010167 Bacteria 1170
120 Ga0466735_035377 3300042624 Bacteria 6944
121 Ga0466703_010863 3300042636 Bacteria 38457
122 Ga0466703_214854 3300042636 Bacteria 3697
123 Ga0466704_592132 3300042643 Bacteria 1814
124 Ga0466708_024450 3300042652 Bacteria 2973
125 Ga0466712_022854 3300042614 Bacteria 2884
126 Ga0466712_235450 3300042614 Unclassified 1382
127 Ga0466711_278536 3300042615 Bacteria 2764
128 Ga0466729_129073 3300042621 Bacteria 1135
129 Ga0466707_086845 3300042601 Bacteria 1154
130 Ga0466707_405867 3300042601 Bacteria 2915
131 JGI24698J34947_10003594 3300002449 Bacteria 8423
132 JGI24695J34938_10003647 3300002450 Bacteria 10567
133 Ga0264413_121020 3300024493 Bacteria 1509
134 Ga0466691_102279 3300042593 Bacteria 4705
135 Ga0466691_106456 3300042593 Bacteria 7416
136 Ga0466705_351091 3300042612 Bacteria 6034
137 Ga0466732_435157 3300042656 Bacteria 1841
138 Ga0466735_036030 3300042624 Bacteria 1735
139 Ga0466727_243069 3300042655 Bacteria 1169
140 Ga0466712_285185 3300042614 Bacteria 2141
141 Ga0466723_239088 3300042618 Bacteria 4312
142 Ga0466728_020618 3300042620 Bacteria 3906
143 Ga0466728_044083 3300042620 Bacteria 2196
144 Ga0466716_221761 3300042605 Bacteria 1907
145 Ga0466719_048724 3300042606 Bacteria 3149
146 Ga0466719_094719 3300042606 Bacteria 35699
147 Ga0466719_284785 3300042606 Bacteria 11553
148 Ga0466720_173735 3300042607 Bacteria 1826
149 Ga0466720_174969 3300042607 Bacteria 8823
150 JGI24698J34947_10011249 3300002449 Bacteria 4913
151 JGI24698J34947_10100294 3300002449 Unclassified 1304
152 Ga0466690_184731 3300042590 Bacteria 8122
153 Ga0466694_221018 3300042594 Bacteria 1878
154 Ga0466696_252281 3300042596 Bacteria 2991

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300041968 Ga0456237_0016775 Ga0456237_0016775_37_732 231
2 3300042607 Ga0466720_186658 Ga0466720_186658_417_1196 240
3 3300042621 Ga0466729_129073 Ga0466729_129073_388_1125 245
4 3300042614 Ga0466712_082466 Ga0466712_082466_465_1205 246
5 3300042643 Ga0466704_221950 Ga0466704_221950_27_773 248
6 3300042590 Ga0466690_042215 Ga0466690_042215_561_1319 252
7 3300042590 Ga0466690_401174 Ga0466690_401174_39_797 252
8 3300042607 Ga0466720_173735 Ga0466720_173735_562_1371 252
9 3300042614 Ga0466712_246164 Ga0466712_246164_12_770 252
10 3300042597 Ga0466699_079848 Ga0466699_079848_1521_2282 253
11 3300042607 Ga0466720_011873 Ga0466720_011873_102_863 253
12 3300042648 Ga0466709_259608 Ga0466709_259608_6150_6914 254
13 3300010049 Ga0123356_10013022 Ga0123356_100130229 255
14 3300042612 Ga0466705_351091 Ga0466705_351091_4346_5113 255
15 3300042616 Ga0466715_154919 Ga0466715_154919_3915_4682 255
16 3300042597 Ga0466699_291512 Ga0466699_291512_211_981 256
17 3300042605 Ga0466716_221761 Ga0466716_221761_1008_1808 256
18 3300042607 Ga0466720_009999 Ga0466720_009999_5146_5916 256
19 3300042614 Ga0466712_022854 Ga0466712_022854_1362_2132 256
20 3300042614 Ga0466712_081472 Ga0466712_081472_3611_4381 256
21 3300042614 Ga0466712_153651 Ga0466712_153651_662_1432 256
22 3300042614 Ga0466712_204971 Ga0466712_204971_28_798 256
23 3300042614 Ga0466712_235450 Ga0466712_235450_294_1064 256
24 3300042614 Ga0466712_285185 Ga0466712_285185_1247_2017 256
25 3300002449 JGI24698J34947_10002680 JGI24698J34947_100026809 257
26 3300002449 JGI24698J34947_10015927 JGI24698J34947_100159274 257
27 3300002449 JGI24698J34947_10017715 JGI24698J34947_100177155 257
28 3300002449 JGI24698J34947_10029868 JGI24698J34947_100298685 257
29 3300002449 JGI24698J34947_10051724 JGI24698J34947_100517243 257
30 3300002449 JGI24698J34947_10066139 JGI24698J34947_100661392 257
31 3300002449 JGI24698J34947_10100294 JGI24698J34947_101002941 257
32 3300042596 Ga0466696_143907 Ga0466696_143907_262_1035 257
33 3300042596 Ga0466696_210894 Ga0466696_210894_386_1162 258
34 3300042618 Ga0466723_160805 Ga0466723_160805_1920_2696 258
35 3300042652 Ga0466708_109511 Ga0466708_109511_7260_8036 258
36 3300002450 JGI24695J34938_10007095 JGI24695J34938_100070952 259
37 3300010167 Ga0123353_10941268 Ga0123353_109412682 259
38 3300024493 Ga0264413_106803 Ga0264413_1068036 259
39 3300024493 Ga0264413_115566 Ga0264413_1155665 259
40 3300042593 Ga0466691_005002 Ga0466691_005002_1118_1897 259
41 3300042607 Ga0466720_040240 Ga0466720_040240_1771_2550 259
42 3300042607 Ga0466720_153295 Ga0466720_153295_492_1271 259
43 3300042607 Ga0466720_174969 Ga0466720_174969_1954_2733 259
44 3300042618 Ga0466723_006517 Ga0466723_006517_10948_11727 259
45 3300042624 Ga0466735_035377 Ga0466735_035377_164_973 259
46 3300042652 Ga0466708_023393 Ga0466708_023393_2824_3603 259
47 iso_pr_bacteria 2781125658 2781324716 259
48 3300002449 JGI24698J34947_10011249 JGI24698J34947_100112493 260
49 3300010049 Ga0123356_10000406 Ga0123356_1000040645 260
50 3300042600 Ga0466700_299947 Ga0466700_299947_734_1516 260
51 3300042609 Ga0466722_211545 Ga0466722_211545_877_1659 260
52 iso_pr_bacteria 2781125633 2781272559 260
53 3300002450 JGI24695J34938_10003647 JGI24695J34938_100036477 261
54 3300005201 Ga0072941_1010098 Ga0072941_10100989 261
55 3300009826 Ga0123355_10020536 Ga0123355_100205362 261
56 3300024493 Ga0264413_121020 Ga0264413_1210201 261
57 3300042607 Ga0466720_023154 Ga0466720_023154_30363_31148 261
58 3300042618 Ga0466723_096020 Ga0466723_096020_5500_6285 261
59 3300042620 Ga0466728_044083 Ga0466728_044083_1078_1863 261
60 3300042622 Ga0466731_299879 Ga0466731_299879_176_961 261
61 3300042597 Ga0466699_061473 Ga0466699_061473_561_1349 262
62 3300042607 Ga0466720_069212 Ga0466720_069212_3243_4031 262
63 3300042643 Ga0466704_592132 Ga0466704_592132_634_1422 262
64 3300002449 JGI24698J34947_10003594 JGI24698J34947_100035946 263
65 3300002449 JGI24698J34947_10057290 JGI24698J34947_100572902 263
66 3300005201 Ga0072941_1005893 Ga0072941_100589311 263
67 3300042590 Ga0466690_184731 Ga0466690_184731_5391_6182 263
68 3300042607 Ga0466720_006499 Ga0466720_006499_4894_5685 263
69 3300042607 Ga0466720_149801 Ga0466720_149801_10098_10889 263
70 3300042607 Ga0466720_233106 Ga0466720_233106_33568_34359 263
71 3300042617 Ga0466718_103258 Ga0466718_103258_1794_2585 263
72 3300042618 Ga0466723_155358 Ga0466723_155358_1271_2062 263
73 3300042619 Ga0466726_469940 Ga0466726_469940_792_1583 263
74 3300042620 Ga0466728_049517 Ga0466728_049517_1071_1862 263
75 3300042643 Ga0466704_232614 Ga0466704_232614_19_810 263
76 3300042656 Ga0466732_339863 Ga0466732_339863_2411_3202 263
77 3300042656 Ga0466732_435157 Ga0466732_435157_399_1190 263
78 iso_pr_bacteria 2781125693 2781434144 263
79 3300042606 Ga0466719_094719 Ga0466719_094719_23073_23867 264
80 3300042607 Ga0466720_117641 Ga0466720_117641_3895_4689 264
81 3300042655 Ga0466727_243069 Ga0466727_243069_146_940 264
82 3300042594 Ga0466694_221018 Ga0466694_221018_474_1271 265
83 3300042607 Ga0466720_218634 Ga0466720_218634_289_1086 265
84 3300042621 Ga0466729_307080 Ga0466729_307080_768_1565 265
85 3300000089 AustNasuHG_c1000196 AustNasuHG_100019612 266
86 3300002450 JGI24695J34938_10005531 JGI24695J34938_100055315 266
87 3300024493 Ga0264413_122423 Ga0264413_1224235 266
88 3300042612 Ga0466705_349749 Ga0466705_349749_1212_2012 266
89 3300042643 Ga0466704_209487 Ga0466704_209487_30521_31321 266
90 3300042593 Ga0466691_106456 Ga0466691_106456_3479_4282 267
91 3300042596 Ga0466696_252281 Ga0466696_252281_519_1322 267
92 3300042607 Ga0466720_077344 Ga0466720_077344_36_839 267
93 3300042620 Ga0466728_078215 Ga0466728_078215_2387_3190 267
94 3300042596 Ga0466696_082242 Ga0466696_082242_4387_5193 268
95 3300042601 Ga0466707_279247 Ga0466707_279247_672_1478 268
96 3300042612 Ga0466705_108985 Ga0466705_108985_196_1002 268
97 3300042612 Ga0466705_138823 Ga0466705_138823_1292_2098 268
98 3300042612 Ga0466705_488971 Ga0466705_488971_4375_5181 268
99 3300042615 Ga0466711_278536 Ga0466711_278536_1752_2558 268
100 3300042624 Ga0466735_036030 Ga0466735_036030_569_1375 268
101 3300042636 Ga0466703_053982 Ga0466703_053982_6493_7299 268
102 3300042636 Ga0466703_232321 Ga0466703_232321_3806_4612 268
103 3300042643 Ga0466704_248035 Ga0466704_248035_425_1231 268
104 3300042590 Ga0466690_152887 Ga0466690_152887_3110_3919 269
105 3300042593 Ga0466691_102279 Ga0466691_102279_3572_4381 269
106 3300042593 Ga0466691_120345 Ga0466691_120345_2059_2868 269
107 3300042606 Ga0466719_331483 Ga0466719_331483_1184_1993 269
108 3300042620 Ga0466728_063252 Ga0466728_063252_1612_2421 269
109 3300042624 Ga0466735_198670 Ga0466735_198670_143_952 269
110 3300042636 Ga0466703_010863 Ga0466703_010863_9357_10166 269
111 3300042636 Ga0466703_214854 Ga0466703_214854_1465_2274 269
112 3300042652 Ga0466708_077544 Ga0466708_077544_904_1713 269
113 3300042652 Ga0466708_389577 Ga0466708_389577_52176_52985 269
114 iso_pr_bacteria 650716102 650881838 269
115 3300042593 Ga0466691_025299 Ga0466691_025299_217_1029 270
116 3300042594 Ga0466694_203898 Ga0466694_203898_11456_12268 270
117 3300042605 Ga0466716_247787 Ga0466716_247787_5540_6352 270
118 3300042606 Ga0466719_284785 Ga0466719_284785_6302_7114 270
119 3300042616 Ga0466715_174577 Ga0466715_174577_143_955 270
120 3300042648 Ga0466709_412505 Ga0466709_412505_355_1167 270
121 3300042601 Ga0466707_086845 Ga0466707_086845_284_1099 271
122 3300042601 Ga0466707_341621 Ga0466707_341621_79_894 271
123 3300042605 Ga0466716_066787 Ga0466716_066787_300_1139 271
124 3300042606 Ga0466719_048724 Ga0466719_048724_482_1297 271
125 3300042606 Ga0466719_390155 Ga0466719_390155_182_997 271
126 3300042612 Ga0466705_038488 Ga0466705_038488_355_1170 271
127 3300042616 Ga0466715_098690 Ga0466715_098690_478_1293 271
128 3300042652 Ga0466708_013013 Ga0466708_013013_2888_3703 271
129 3300042601 Ga0466707_176047 Ga0466707_176047_294_1112 272
130 3300042601 Ga0466707_365356 Ga0466707_365356_668_1489 273
131 3300042618 Ga0466723_088657 Ga0466723_088657_693_1514 273
132 3300042616 Ga0466715_270970 Ga0466715_270970_1610_2434 274
133 3300042618 Ga0466723_196144 Ga0466723_196144_1435_2259 274
134 3300042643 Ga0466704_341458 Ga0466704_341458_435_1259 274
135 3300042655 Ga0466727_069864 Ga0466727_069864_304_1128 274
136 3300042655 Ga0466727_149806 Ga0466727_149806_1942_2766 274
137 3300042616 Ga0466715_357417 Ga0466715_357417_73_900 275
138 3300042648 Ga0466709_075030 Ga0466709_075030_2692_3519 275
139 3300042601 Ga0466707_261228 Ga0466707_261228_246_1076 276
140 3300042601 Ga0466707_405867 Ga0466707_405867_799_1629 276
141 3300042612 Ga0466705_046514 Ga0466705_046514_2988_3818 276
142 3300042618 Ga0466723_194702 Ga0466723_194702_1436_2266 276
143 3300042620 Ga0466728_020618 Ga0466728_020618_10_855 276
144 3300042605 Ga0466716_439008 Ga0466716_439008_3052_3885 277
145 3300042648 Ga0466709_101846 Ga0466709_101846_2969_3802 277
146 3300042593 Ga0466691_014861 Ga0466691_014861_1091_1927 278
147 3300042618 Ga0466723_239088 Ga0466723_239088_1767_2606 279
148 3300042652 Ga0466708_024450 Ga0466708_024450_208_1047 279
149 3300042606 Ga0466719_096424 Ga0466719_096424_851_1693 280
150 3300042618 Ga0466723_304311 Ga0466723_304311_2901_3743 280
151 3300042652 Ga0466708_464475 Ga0466708_464475_12687_13529 280
152 3300042616 Ga0466715_086582 Ga0466715_086582_1977_2822 281
153 3300042616 Ga0466715_260123 Ga0466715_260123_923_1768 281
154 3300042618 Ga0466723_105383 Ga0466723_105383_1397_2251 284
155 3300042618 Ga0466723_298435 Ga0466723_298435_1349_2206 285
156 3300042593 Ga0466691_116209 Ga0466691_116209_2760_3620 286
157 3300042636 Ga0466703_065803 Ga0466703_065803_7132_7998 288
158 3300042648 Ga0466709_140248 Ga0466709_140248_4473_5435 320

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus 1 123 0.82
PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus 126 269 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.