Protein Family IF09114

Metagenome Isolate
169 Members
66 Samples
150 Scaffolds
267.57 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_052763|Ga0466703_052763_6289_7215
Length
308 aa
Sequence
LLSLSYYAATRIQPGLFFLANFVYIRVDIVYGGTDMNQNPAPSGHVSCPHCGTITDIETFQRAHKVCGKCNYHTRLNWQERLECTADPGSFKELDPEMESKNPIGFPDYEGKIGALQKNCKTREAVVTGEITINGYPAVIGVMDSYFMMGSMGSVVGEKITRALEYGTAKKLPVIIFTTSGGARMQEGIFSLMQMAKTSGAVARHNEAGQLYISVITDPTTGGVTASFATLGDIIIAEPGALIGFAGKRVIQDTIGQKLPDRFQTAEFVQEHGFTDIIVPRSKMRNILTRFLRMHLPGASTLRGKEAV

📊 Sample Types

Isolate 11.2%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.7%
Unclassified 25.0%
Kalotermitidae 21.9%
Rhinotermitidae 6.2%
Termopsidae 4.7%
Apidae 3.1%
Passalidae 3.1%
Hodotermitidae 1.6%
Scarabaeidae 1.6%
Elmidae 1.6%
Armadillidiidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 162
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
2 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
3 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
4 2627854132 Campylobacter peloridis LMG 23910 Isolate Unclassified
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
16 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
19 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
20 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
27 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
28 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
29 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
30 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
40 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2870004507 Campylobacter coli 14983A Isolate Unclassified
49 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
50 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
57 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
58 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
59 650716102 Treponema primitia ZAS-2 Isolate Unclassified
60 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
61 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
62 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
63 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
64 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_118554 3300042612 Bacteria 4730
2 Ga0466705_196362 3300042612 Bacteria 6706
3 Ga0466705_322930 3300042612 Bacteria 7670
4 Ga0466733_007439 3300042659 Bacteria 24356
5 JGI24695J34938_10018877 3300002450 Bacteria 3433
6 JGI24695J34938_10048420 3300002450 Bacteria 1872
7 Ga0068305_10268578 3300005083 Bacteria 1618
8 Ga0415639_223739 3300038395 Bacteria 1498
9 Ga0466690_046931 3300042590 Bacteria 2228
10 Ga0466692_046346 3300042591 Bacteria 7154
11 Ga0466693_292427 3300042592 Bacteria 1186
12 Ga0466691_129158 3300042593 Bacteria 30130
13 Ga0466718_052095 3300042617 Bacteria 6665
14 Ga0123353_10894487 3300010167 Bacteria 1210
15 Ga0466706_174067 3300042599 Bacteria 69356
16 Ga0466700_118532 3300042600 Bacteria 2842
17 Ga0466714_049523 3300042603 Bacteria 1559
18 Ga0466719_265187 3300042606 Bacteria 1723
19 Ga0466703_052763 3300042636 Bacteria 9144
20 Ga0466703_098927 3300042636 Bacteria 24801
21 Ga0466704_301502 3300042643 Bacteria 29784
22 Ga0466704_340096 3300042643 Bacteria 1070
23 Ga0466709_263507 3300042648 Bacteria 2761
24 Ga0466727_034945 3300042655 Bacteria 1158
25 Ga0466705_064004 3300042612 Bacteria 7889
26 Ga0466733_115042 3300042659 Bacteria 8117
27 Ga0466733_142022 3300042659 Bacteria 7869
28 2227487420 2225789004 Bacteria 4204
29 IMNBL1DRAFT_c0000044 3300000062 Bacteria 114546
30 JGI24695J34938_10054006 3300002450 Bacteria 1744
31 Ga0466691_009179 3300042593 Bacteria 2784
32 Ga0466691_104254 3300042593 Bacteria 10326
33 Ga0466694_255516 3300042594 Bacteria 1425
34 Ga0466711_094319 3300042615 Bacteria 9155
35 Ga0466715_407700 3300042616 Bacteria 7439
36 Ga0466718_146634 3300042617 Bacteria 18755
37 Ga0466723_061062 3300042618 Bacteria 33737
38 Ga0466714_049014 3300042603 Bacteria 50282
39 Ga0466716_077923 3300042605 Bacteria 9497
40 Ga0466722_160110 3300042609 Bacteria 27287
41 Ga0466727_055904 3300042655 Bacteria 3535
42 JGI24695J34938_10010999 3300002450 Bacteria 4912
43 Ga0072940_1049168 3300005200 Bacteria 6904
44 Ga0456237_0009708 3300041968 Bacteria 1431
45 Ga0466690_017336 3300042590 Bacteria 17990
46 Ga0466696_451184 3300042596 Bacteria 9729
47 Ga0466715_535386 3300042616 Unclassified 2453
48 Ga0466723_099381 3300042618 Bacteria 45625
49 Ga0466726_044505 3300042619 Bacteria 34716
50 Ga0466726_479502 3300042619 Bacteria 11718
51 Ga0123355_10717860 3300009826 Bacteria 1141
52 Ga0123353_10544836 3300010167 Bacteria 1675
53 Ga0160464_101697 3300012805 Bacteria 6267
54 Ga0466700_002221 3300042600 Unclassified 1730
55 Ga0466716_324924 3300042605 Bacteria 2027
56 Ga0466719_420892 3300042606 Bacteria 6123
57 Ga0466703_185580 3300042636 Bacteria 3383
58 Ga0466708_287596 3300042652 Bacteria 10158
59 Ga0466727_254323 3300042655 Bacteria 2622
60 Ga0466727_288491 3300042655 Bacteria 61584
61 Ga0466705_052750 3300042612 Bacteria 3102
62 Ga0466733_002163 3300042659 Bacteria 2087
63 AustNasuHG_c1014967 3300000089 Bacteria 2626
64 JGI24695J34938_10002276 3300002450 Bacteria 14821
65 Ga0160445_105942 3300012847 Bacteria 2036
66 Ga0466692_138760 3300042591 Bacteria 9180
67 Ga0466715_051983 3300042616 Bacteria 7067
68 Ga0466726_477644 3300042619 Bacteria 2464
69 Ga0466728_299172 3300042620 Bacteria 6335
70 Ga0123355_10021588 3300009826 Bacteria 10307
71 Ga0123356_10000443 3300010049 Bacteria 47239
72 Ga0123356_10276475 3300010049 Bacteria 1772
73 Ga0123353_10753097 3300010167 Bacteria 1355
74 Ga0466706_176474 3300042599 Bacteria 2399
75 Ga0466716_111971 3300042605 Bacteria 10084
76 Ga0466702_140498 3300042635 Bacteria 2625
77 Ga0466704_051108 3300042643 Bacteria 9065
78 Ga0466725_319496 3300042654 Bacteria 1934
79 Ga0466705_124090 3300042612 Bacteria 3668
80 JGI24695J34938_10005699 3300002450 Bacteria 7689
81 Ga0068305_10001806 3300005083 Bacteria 20416
82 Ga0068305_10033509 3300005083 Bacteria 17914
83 Ga0456237_0000756 3300041968 Bacteria 5007
84 Ga0466691_064265 3300042593 Unclassified 1478
85 Ga0466691_098937 3300042593 Bacteria 12001
86 Ga0466715_093956 3300042616 Bacteria 2594
87 Ga0466728_194599 3300042620 Bacteria 3997
88 Ga0123355_10003524 3300009826 Bacteria 22464
89 Ga0123353_11000206 3300010167 Bacteria 1124
90 Ga0466706_232761 3300042599 Bacteria 14330
91 Ga0466700_156919 3300042600 Bacteria 1209
92 Ga0466707_073077 3300042601 Bacteria 2209
93 Ga0466707_299201 3300042601 Bacteria 2070
94 Ga0466719_202519 3300042606 Bacteria 25647
95 Ga0466703_021914 3300042636 Bacteria 11318
96 Ga0466703_037201 3300042636 Bacteria 6431
97 Ga0466727_325696 3300042655 Bacteria 2498
98 Ga0466705_159340 3300042612 Bacteria 11079
99 Ga0068302_10188643 3300005071 Unclassified 1754
100 Ga0466690_042690 3300042590 Bacteria 1434
101 Ga0466718_062459 3300042617 Bacteria 5202
102 Ga0466726_335689 3300042619 Bacteria 1812
103 Ga0123355_10295390 3300009826 Bacteria 2217
104 Ga0123356_10000870 3300010049 Bacteria 33535
105 Ga0123356_10059478 3300010049 Bacteria 3564
106 Ga0160454_100141 3300012798 Bacteria 86809
107 Ga0466717_019389 3300042604 Bacteria 2864
108 Ga0466719_246711 3300042606 Bacteria 1287
109 Ga0466719_332429 3300042606 Bacteria 19103
110 Ga0466729_248815 3300042621 Bacteria 1236
111 Ga0466704_377097 3300042643 Bacteria 7987
112 Ga0466704_412649 3300042643 Bacteria 8139
113 Ga0466727_085083 3300042655 Bacteria 1621
114 Ga0466727_232519 3300042655 Bacteria 7095
115 Ga0466705_071649 3300042612 Bacteria 8104
116 JGI24700J35501_10930878 3300002508 Bacteria 32238
117 Ga0415639_024480 3300038395 Bacteria 18993
118 Ga0466696_022290 3300042596 Bacteria 7119
119 Ga0466696_076757 3300042596 Bacteria 4216
120 Ga0466711_352525 3300042615 Bacteria 66792
121 Ga0466723_008088 3300042618 Bacteria 14230
122 Ga0466726_033472 3300042619 Bacteria 17135
123 Ga0123356_10397306 3300010049 Unclassified 1515
124 Ga0466704_205437 3300042643 Bacteria 4141
125 Ga0466705_082072 3300042612 Bacteria 49126
126 Ga0466733_056180 3300042659 Bacteria 2099
127 Ga0466733_183100 3300042659 Bacteria 1668
128 JGI24695J34938_10001740 3300002450 Bacteria 18007
129 JGI24695J34938_10053438 3300002450 Unclassified 1757
130 Ga0456237_0007870 3300041968 Unclassified 1630
131 Ga0466690_025431 3300042590 Bacteria 3236
132 Ga0466690_251136 3300042590 Bacteria 7913
133 Ga0466696_022862 3300042596 Bacteria 3974
134 Ga0466715_149053 3300042616 Bacteria 10951
135 Ga0466726_268175 3300042619 Bacteria 27512
136 Ga0123355_10006486 3300009826 Bacteria 17349
137 Ga0123355_10008062 3300009826 Bacteria 15888
138 Ga0123355_10255905 3300009826 Bacteria 2457
139 Ga0123355_10323841 3300009826 Bacteria 2073
140 Ga0123353_10638677 3300010167 Bacteria 1510
141 Ga0123354_10323656 3300010882 Bacteria 1418
142 Ga0466707_053223 3300042601 Bacteria 12046
143 Ga0466716_076866 3300042605 Bacteria 7068
144 Ga0466716_393695 3300042605 Bacteria 5492
145 Ga0466719_409311 3300042606 Bacteria 2961
146 Ga0466704_110556 3300042643 Bacteria 2698
147 Ga0466709_305276 3300042648 Bacteria 3433
148 Ga0466708_423789 3300042652 Bacteria 1412
149 Ga0466727_129776 3300042655 Bacteria 3048
150 Ga0466727_261458 3300042655 Bacteria 1683

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_022862 Ga0466696_022862_182_865 227
2 3300042615 Ga0466711_094319 Ga0466711_094319_5189_5872 227
3 3300042612 Ga0466705_196362 Ga0466705_196362_4758_5444 228
4 3300042605 Ga0466716_076866 Ga0466716_076866_4703_5392 229
5 3300009826 Ga0123355_10255905 Ga0123355_102559052 233
6 3300041968 Ga0456237_0007870 Ga0456237_0007870_915_1616 233
7 3300009826 Ga0123355_10323841 Ga0123355_103238411 238
8 3300000089 AustNasuHG_c1014967 AustNasuHG_10149672 246
9 3300042605 Ga0466716_324924 Ga0466716_324924_1045_1788 247
10 3300042617 Ga0466718_052095 Ga0466718_052095_4327_5118 247
11 3300042619 Ga0466726_268175 Ga0466726_268175_4453_5199 248
12 3300042659 Ga0466733_007439 Ga0466733_007439_19634_20422 248
13 3300042601 Ga0466707_053223 Ga0466707_053223_2541_3347 249
14 3300042596 Ga0466696_076757 Ga0466696_076757_2353_3159 250
15 3300042648 Ga0466709_263507 Ga0466709_263507_1647_2399 250
16 3300042655 Ga0466727_288491 Ga0466727_288491_29826_30635 250
17 3300005071 Ga0068302_10188643 Ga0068302_101886432 252
18 3300042592 Ga0466693_292427 Ga0466693_292427_201_992 252
19 3300042603 Ga0466714_049523 Ga0466714_049523_118_903 252
20 3300042652 Ga0466708_423789 Ga0466708_423789_311_1117 252
21 3300002450 JGI24695J34938_10053438 JGI24695J34938_100534382 253
22 3300042590 Ga0466690_251136 Ga0466690_251136_1174_1980 253
23 3300042599 Ga0466706_174067 Ga0466706_174067_45963_46724 253
24 3300042636 Ga0466703_098927 Ga0466703_098927_21180_21980 253
25 3300042606 Ga0466719_409311 Ga0466719_409311_562_1356 254
26 3300042612 Ga0466705_159340 Ga0466705_159340_5852_6688 254
27 3300042643 Ga0466704_412649 Ga0466704_412649_4112_4948 254
28 3300042655 Ga0466727_325696 Ga0466727_325696_263_1054 254
29 3300002450 JGI24695J34938_10018877 JGI24695J34938_100188774 255
30 3300041968 Ga0456237_0000756 Ga0456237_0000756_410_1216 255
31 3300042590 Ga0466690_017336 Ga0466690_017336_5981_6793 255
32 3300042591 Ga0466692_046346 Ga0466692_046346_1060_1866 255
33 3300042615 Ga0466711_352525 Ga0466711_352525_26263_27069 255
34 3300042618 Ga0466723_061062 Ga0466723_061062_27501_28313 255
35 3300002450 JGI24695J34938_10048420 JGI24695J34938_100484202 256
36 3300042612 Ga0466705_071649 Ga0466705_071649_4337_5107 256
37 3300042612 Ga0466705_322930 Ga0466705_322930_102_905 256
38 3300042606 Ga0466719_202519 Ga0466719_202519_2136_2924 257
39 3300042616 Ga0466715_407700 Ga0466715_407700_349_1143 257
40 3300042617 Ga0466718_062459 Ga0466718_062459_86_877 257
41 3300042619 Ga0466726_479502 Ga0466726_479502_6640_7470 257
42 3300042600 Ga0466700_002221 Ga0466700_002221_114_908 258
43 3300042600 Ga0466700_118532 Ga0466700_118532_1039_1815 258
44 3300042616 Ga0466715_051983 Ga0466715_051983_770_1573 258
45 3300042659 Ga0466733_056180 Ga0466733_056180_482_1282 258
46 3300010167 Ga0123353_10544836 Ga0123353_105448362 259
47 3300042655 Ga0466727_085083 Ga0466727_085083_796_1596 259
48 3300042655 Ga0466727_261458 Ga0466727_261458_207_986 259
49 iso_pr_bacteria 2781125685 2781417839 259
50 3300002450 JGI24695J34938_10054006 JGI24695J34938_100540062 260
51 3300042593 Ga0466691_129158 Ga0466691_129158_17763_18566 260
52 3300042599 Ga0466706_176474 Ga0466706_176474_235_1017 260
53 3300042618 Ga0466723_099381 Ga0466723_099381_35466_36269 260
54 3300042648 Ga0466709_305276 Ga0466709_305276_924_1751 260
55 3300042655 Ga0466727_055904 Ga0466727_055904_1930_2736 260
56 3300042593 Ga0466691_064265 Ga0466691_064265_601_1386 261
57 3300042619 Ga0466726_477644 Ga0466726_477644_421_1206 261
58 3300042636 Ga0466703_185580 Ga0466703_185580_2372_3199 261
59 iso_pr_bacteria 2781125633 2781272689 261
60 3300002450 JGI24695J34938_10001740 JGI24695J34938_1000174011 262
61 3300002450 JGI24695J34938_10002276 JGI24695J34938_1000227614 262
62 3300042605 Ga0466716_393695 Ga0466716_393695_3585_4373 262
63 3300042612 Ga0466705_064004 Ga0466705_064004_6297_7100 262
64 3300042655 Ga0466727_129776 Ga0466727_129776_236_1024 262
65 3300042655 Ga0466727_232519 Ga0466727_232519_4245_5033 262
66 iso_pr_bacteria 2781125665 2781342259 262
67 iso_pr_bacteria 2781125682 2781410043 262
68 iso_pr_bacteria 2827179085 2827185814 262
69 3300002450 JGI24695J34938_10005699 JGI24695J34938_100056994 263
70 3300010049 Ga0123356_10000870 Ga0123356_100008702 263
71 3300010049 Ga0123356_10059478 Ga0123356_100594783 263
72 3300042591 Ga0466692_138760 Ga0466692_138760_6759_7592 264
73 3300042601 Ga0466707_073077 Ga0466707_073077_172_966 264
74 3300042609 Ga0466722_160110 Ga0466722_160110_11063_11857 264
75 3300042612 Ga0466705_052750 Ga0466705_052750_1883_2722 264
76 3300042621 Ga0466729_248815 Ga0466729_248815_82_876 264
77 iso_pr_bacteria 2781125687 2781421487 264
78 3300042601 Ga0466707_299201 Ga0466707_299201_996_1793 265
79 3300042655 Ga0466727_034945 Ga0466727_034945_100_927 265
80 3300002450 JGI24695J34938_10010999 JGI24695J34938_100109994 266
81 3300042596 Ga0466696_451184 Ga0466696_451184_2437_3270 266
82 3300042636 Ga0466703_021914 Ga0466703_021914_3118_3918 266
83 3300010049 Ga0123356_10000443 Ga0123356_1000044345 267
84 3300042606 Ga0466719_420892 Ga0466719_420892_4571_5374 267
85 3300042618 Ga0466723_008088 Ga0466723_008088_2784_3626 267
86 3300010167 Ga0123353_11000206 Ga0123353_110002062 268
87 3300042612 Ga0466705_082072 Ga0466705_082072_33808_34641 268
88 3300042636 Ga0466703_037201 Ga0466703_037201_1589_2395 268
89 3300042643 Ga0466704_377097 Ga0466704_377097_3982_4788 268
90 3300010167 Ga0123353_10894487 Ga0123353_108944872 269
91 3300041968 Ga0456237_0009708 Ga0456237_0009708_283_1092 269
92 3300042596 Ga0466696_022290 Ga0466696_022290_439_1248 269
93 3300042606 Ga0466719_265187 Ga0466719_265187_376_1221 269
94 3300010049 Ga0123356_10276475 Ga0123356_102764752 270
95 3300042590 Ga0466690_025431 Ga0466690_025431_1068_1880 270
96 3300042590 Ga0466690_046931 Ga0466690_046931_1250_2062 270
97 3300042593 Ga0466691_009179 Ga0466691_009179_64_876 270
98 3300042600 Ga0466700_156919 Ga0466700_156919_352_1164 270
99 3300042605 Ga0466716_111971 Ga0466716_111971_6050_6862 270
100 3300042606 Ga0466719_332429 Ga0466719_332429_13691_14503 270
101 3300042612 Ga0466705_118554 Ga0466705_118554_267_1079 270
102 3300042616 Ga0466715_149053 Ga0466715_149053_931_1788 270
103 3300042593 Ga0466691_098937 Ga0466691_098937_4639_5457 272
104 3300042593 Ga0466691_104254 Ga0466691_104254_4487_5305 272
105 iso_pr_bacteria 2781125655 2781318602 272
106 iso_pr_bacteria 650716102 650883663 272
107 3300009826 Ga0123355_10008062 Ga0123355_100080629 273
108 3300009826 Ga0123355_10295390 Ga0123355_102953902 273
109 3300042605 Ga0466716_077923 Ga0466716_077923_1902_2723 273
110 3300042612 Ga0466705_124090 Ga0466705_124090_490_1311 273
111 3300042616 Ga0466715_093956 Ga0466715_093956_377_1198 273
112 3300042620 Ga0466728_299172 Ga0466728_299172_166_987 273
113 3300042652 Ga0466708_287596 Ga0466708_287596_6131_6952 273
114 3300042643 Ga0466704_340096 Ga0466704_340096_119_943 274
115 3300042655 Ga0466727_254323 Ga0466727_254323_867_1691 274
116 3300009826 Ga0123355_10006486 Ga0123355_1000648616 275
117 3300042619 Ga0466726_044505 Ga0466726_044505_18410_19237 275
118 3300042643 Ga0466704_205437 Ga0466704_205437_2998_3825 275
119 3300005083 Ga0068305_10001806 Ga0068305_1000180616 276
120 3300042590 Ga0466690_042690 Ga0466690_042690_227_1057 276
121 3300042616 Ga0466715_535386 Ga0466715_535386_256_1086 276
122 3300042619 Ga0466726_033472 Ga0466726_033472_15735_16610 276
123 3300042620 Ga0466728_194599 Ga0466728_194599_2199_3029 276
124 3300042643 Ga0466704_051108 Ga0466704_051108_7049_7879 276
125 3300010167 Ga0123353_10638677 Ga0123353_106386772 277
126 3300038395 Ga0415639_223739 Ga0415639_223739_440_1273 277
127 3300042619 Ga0466726_335689 Ga0466726_335689_749_1582 277
128 3300005083 Ga0068305_10033509 Ga0068305_100335092 278
129 3300042606 Ga0466719_246711 Ga0466719_246711_206_1093 280
130 iso_pr_bacteria 2627854132 2630357327 280
131 iso_pr_bacteria 2870004507 2870006338 280
132 3300042643 Ga0466704_110556 Ga0466704_110556_1321_2166 281
133 3300042659 Ga0466733_002163 Ga0466733_002163_362_1207 281
134 3300042659 Ga0466733_115042 Ga0466733_115042_1792_2637 281
135 3300009826 Ga0123355_10021588 Ga0123355_100215887 282
136 3300038395 Ga0415639_024480 Ga0415639_024480_10280_11128 282
137 3300042659 Ga0466733_183100 Ga0466733_183100_338_1186 282
138 iso_pr_bacteria 2820306284 2820309260 282
139 iso_pr_bacteria 2864816158 2864821171 282
140 3300002508 JGI24700J35501_10930878 JGI24700J35501_1093087810 283
141 3300042617 Ga0466718_146634 Ga0466718_146634_10573_11424 283
142 3300005200 Ga0072940_1049168 Ga0072940_10491686 284
143 3300042594 Ga0466694_255516 Ga0466694_255516_344_1198 284
144 2225789004 2227487420 2227955216 285
145 3300010882 Ga0123354_10323656 Ga0123354_103236562 285
146 iso_pr_bacteria 2820259584 2820261023 285
147 iso_pr_bacteria 2820507989 2820510045 285
148 3300005083 Ga0068305_10268578 Ga0068305_102685781 286
149 iso_pr_bacteria 2820516196 2820517775 286
150 iso_pr_bacteria 2820598593 2820599928 286
151 3300009826 Ga0123355_10003524 Ga0123355_1000352418 287
152 3300009826 Ga0123355_10717860 Ga0123355_107178601 287
153 3300010167 Ga0123353_10753097 Ga0123353_107530971 287
154 3300000062 IMNBL1DRAFT_c0000044 IMNBL1DRAFT_000004484 289
155 3300012798 Ga0160454_100141 Ga0160454_10014121 289
156 3300012805 Ga0160464_101697 Ga0160464_1016973 289
157 3300042643 Ga0466704_301502 Ga0466704_301502_6580_7488 289
158 iso_pr_bacteria 2590828841 2593260673 290
159 3300010049 Ga0123356_10397306 Ga0123356_103973062 291
160 3300042599 Ga0466706_232761 Ga0466706_232761_7412_8287 291
161 3300042635 Ga0466702_140498 Ga0466702_140498_480_1355 291
162 3300042654 Ga0466725_319496 Ga0466725_319496_93_968 291
163 iso_pr_bacteria 2852337885 2852338015 292
164 3300012847 Ga0160445_105942 Ga0160445_1059421 293
165 3300042603 Ga0466714_049014 Ga0466714_049014_36987_37868 293
166 3300042604 Ga0466717_019389 Ga0466717_019389_948_1829 293
167 3300042659 Ga0466733_142022 Ga0466733_142022_5880_6761 293
168 iso_pr_bacteria 2971438493 2971442546 293
169 3300042636 Ga0466703_052763 Ga0466703_052763_6289_7215 308

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01039 Carboxyl_trans Carboxyl transferase domain 79 259 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.