Protein Family IF09112
Metagenome
Isolate
142
Members
55
Samples
123
Scaffolds
305.22
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_052440|Ga0466703_052440_200_1231
- Length
- 343 aa
- Sequence
- MKTSDRRETEKLPAHFFCLFFVSGETFYLHLRLQEPIIMLKKSLVSIDQCTKEDILRIIGNAKKFEENPDRNLLAGKVAATLFFEPSTRTRLSFETAVNRLGGRVVGFQDASTTSSSKGETLKDTILMVSNYVDIIIMRHYLEGAARYASEVTDIPVINAGDGANQHPSQTLLDLYSIKKTQGGLDGLTITMVGDLKYGRTVHSLIVGMSHFSPKFHFIAPDELKMPDEQKRFCQLHGIEFHEHAVFSEDIIAETDILYMTRVQKERFTDLVEYERVKNVYILHNKMLENSKSNLRVLHPLPRVNEIAYDVDDNPKAYYIQQARNGLFTREAIICDVLGIICN
Sample Types
Isolate
13.4%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
34.5%
Kalotermitidae
25.5%
Termitidae
20.0%
Termopsidae
7.3%
Unclassified
5.5%
Rhinotermitidae
3.6%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 23 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 24 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 25 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 26 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 27 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 28 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 35 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 36 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 37 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 47 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 48 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0068305_10055507 | 3300005083 | Bacteria | 8481 |
| 2 | Ga0068305_10055564 | 3300005083 | Bacteria | 18731 |
| 3 | Ga0466715_188075 | 3300042616 | Bacteria | 87062 |
| 4 | Ga0466726_219661 | 3300042619 | Bacteria | 8480 |
| 5 | Ga0466729_031103 | 3300042621 | Bacteria | 19143 |
| 6 | Ga0466735_031150 | 3300042624 | Unclassified | 3024 |
| 7 | Ga0466735_223644 | 3300042624 | Bacteria | 2675 |
| 8 | Ga0466703_274572 | 3300042636 | Bacteria | 12534 |
| 9 | Ga0123353_10069135 | 3300010167 | Bacteria | 5673 |
| 10 | Ga0466705_140360 | 3300042612 | Bacteria | 13000 |
| 11 | Ga0466705_169781 | 3300042612 | Bacteria | 18950 |
| 12 | JGI24702J35022_10000687 | 3300002462 | Bacteria | 20622 |
| 13 | Ga0466710_279467 | 3300042613 | Bacteria | 2035 |
| 14 | Ga0466711_182217 | 3300042615 | Bacteria | 7158 |
| 15 | Ga0466728_337764 | 3300042620 | Bacteria | 49516 |
| 16 | Ga0466709_365428 | 3300042648 | Bacteria | 8404 |
| 17 | Ga0466727_258950 | 3300042655 | Bacteria | 9320 |
| 18 | Ga0466690_058831 | 3300042590 | Unclassified | 4449 |
| 19 | Ga0466690_411604 | 3300042590 | Bacteria | 10208 |
| 20 | Ga0466696_135989 | 3300042596 | Bacteria | 2130 |
| 21 | Ga0466706_175020 | 3300042599 | Bacteria | 3483 |
| 22 | Ga0466713_011874 | 3300042602 | Bacteria | 11655 |
| 23 | JGI24702J35022_10002383 | 3300002462 | Bacteria | 11499 |
| 24 | JGI24702J35022_10050145 | 3300002462 | Bacteria | 2223 |
| 25 | Ga0466715_120257 | 3300042616 | Bacteria | 34712 |
| 26 | Ga0466723_120929 | 3300042618 | Bacteria | 26730 |
| 27 | Ga0466735_027786 | 3300042624 | Bacteria | 3369 |
| 28 | Ga0466727_179063 | 3300042655 | Bacteria | 8325 |
| 29 | Ga0466696_157739 | 3300042596 | Bacteria | 23273 |
| 30 | Ga0466713_152634 | 3300042602 | Bacteria | 19458 |
| 31 | Ga0466733_006417 | 3300042659 | Bacteria | 20786 |
| 32 | Ga0068302_10229902 | 3300005071 | Bacteria | 4786 |
| 33 | Ga0068305_10083417 | 3300005083 | Bacteria | 20277 |
| 34 | Ga0466712_313568 | 3300042614 | Bacteria | 1982 |
| 35 | Ga0466711_318661 | 3300042615 | Bacteria | 2722 |
| 36 | Ga0466715_157292 | 3300042616 | Bacteria | 5418 |
| 37 | Ga0466715_343665 | 3300042616 | Bacteria | 20123 |
| 38 | Ga0466718_038049 | 3300042617 | Bacteria | 1627 |
| 39 | Ga0466726_410456 | 3300042619 | Unclassified | 1415 |
| 40 | Ga0466704_397285 | 3300042643 | Bacteria | 2842 |
| 41 | Ga0466709_193369 | 3300042648 | Bacteria | 7409 |
| 42 | Ga0466709_199995 | 3300042648 | Bacteria | 19280 |
| 43 | Ga0466727_223410 | 3300042655 | Bacteria | 5802 |
| 44 | Ga0466696_074655 | 3300042596 | Bacteria | 12961 |
| 45 | Ga0466713_033740 | 3300042602 | Bacteria | 18936 |
| 46 | Ga0466719_064486 | 3300042606 | Bacteria | 19424 |
| 47 | Ga0466705_022136 | 3300042612 | Bacteria | 7133 |
| 48 | Ga0068305_10077163 | 3300005083 | Unclassified | 10841 |
| 49 | Ga0466723_312949 | 3300042618 | Bacteria | 6558 |
| 50 | Ga0466728_016517 | 3300042620 | Bacteria | 38293 |
| 51 | Ga0466731_426610 | 3300042622 | Bacteria | 2873 |
| 52 | Ga0466703_038209 | 3300042636 | Bacteria | 5328 |
| 53 | Ga0466704_181382 | 3300042643 | Bacteria | 6518 |
| 54 | Ga0466725_047035 | 3300042654 | Bacteria | 4938 |
| 55 | Ga0466656_248118 | 3300042550 | Bacteria | 1725 |
| 56 | Ga0466690_006915 | 3300042590 | Bacteria | 5192 |
| 57 | Ga0466691_035615 | 3300042593 | Bacteria | 6377 |
| 58 | Ga0466691_087899 | 3300042593 | Bacteria | 15107 |
| 59 | Ga0466696_324982 | 3300042596 | Bacteria | 3450 |
| 60 | Ga0466706_111085 | 3300042599 | Bacteria | 3417 |
| 61 | Ga0466700_334631 | 3300042600 | Bacteria | 1311 |
| 62 | Ga0466713_064514 | 3300042602 | Unclassified | 13161 |
| 63 | Ga0466716_051729 | 3300042605 | Bacteria | 13840 |
| 64 | Ga0466722_075834 | 3300042609 | Bacteria | 10831 |
| 65 | Ga0068305_10091325 | 3300005083 | Bacteria | 15766 |
| 66 | Ga0466715_261346 | 3300042616 | Bacteria | 28761 |
| 67 | Ga0466715_381051 | 3300042616 | Bacteria | 5747 |
| 68 | Ga0466723_120993 | 3300042618 | Bacteria | 29616 |
| 69 | Ga0466728_360782 | 3300042620 | Bacteria | 37454 |
| 70 | Ga0466703_121914 | 3300042636 | Unclassified | 5386 |
| 71 | Ga0466703_256155 | 3300042636 | Unclassified | 8293 |
| 72 | Ga0466708_293328 | 3300042652 | Bacteria | 56768 |
| 73 | Ga0466727_282938 | 3300042655 | Bacteria | 7344 |
| 74 | Ga0466691_138795 | 3300042593 | Bacteria | 7312 |
| 75 | Ga0466696_295020 | 3300042596 | Bacteria | 31908 |
| 76 | Ga0466707_025476 | 3300042601 | Bacteria | 9966 |
| 77 | Ga0466716_036664 | 3300042605 | Bacteria | 4367 |
| 78 | Ga0466719_059375 | 3300042606 | Bacteria | 2004 |
| 79 | Ga0466719_122038 | 3300042606 | Bacteria | 8102 |
| 80 | Ga0466722_001372 | 3300042609 | Bacteria | 7070 |
| 81 | Ga0466722_017922 | 3300042609 | Bacteria | 50732 |
| 82 | Ga0466733_144405 | 3300042659 | Bacteria | 17873 |
| 83 | IMNBL1DRAFT_c0000766 | 3300000062 | Bacteria | 25390 |
| 84 | JGI24702J35022_10016202 | 3300002462 | Bacteria | 4088 |
| 85 | Ga0068305_10459535 | 3300005083 | Bacteria | 1043 |
| 86 | Ga0466705_418678 | 3300042612 | Bacteria | 18793 |
| 87 | Ga0466710_229280 | 3300042613 | Bacteria | 5222 |
| 88 | Ga0466711_009358 | 3300042615 | Bacteria | 8515 |
| 89 | Ga0466711_386510 | 3300042615 | Bacteria | 4599 |
| 90 | Ga0466723_068728 | 3300042618 | Bacteria | 7140 |
| 91 | Ga0466728_003769 | 3300042620 | Bacteria | 38145 |
| 92 | Ga0466703_320358 | 3300042636 | Bacteria | 44545 |
| 93 | Ga0466704_093070 | 3300042643 | Bacteria | 10098 |
| 94 | Ga0466704_150058 | 3300042643 | Unclassified | 2826 |
| 95 | Ga0466704_596308 | 3300042643 | Unclassified | 5305 |
| 96 | Ga0466727_207748 | 3300042655 | Bacteria | 4836 |
| 97 | Ga0466690_017646 | 3300042590 | Bacteria | 34395 |
| 98 | Ga0466696_343468 | 3300042596 | Bacteria | 1953 |
| 99 | Ga0123356_10196738 | 3300010049 | Bacteria | 2052 |
| 100 | Ga0466707_135192 | 3300042601 | Bacteria | 4884 |
| 101 | Ga0466713_010763 | 3300042602 | Bacteria | 24879 |
| 102 | Ga0466716_223439 | 3300042605 | Bacteria | 4893 |
| 103 | Ga0466719_215929 | 3300042606 | Bacteria | 11551 |
| 104 | Ga0466719_564922 | 3300042606 | Unclassified | 3557 |
| 105 | Ga0466711_041848 | 3300042615 | Bacteria | 64215 |
| 106 | Ga0466711_090418 | 3300042615 | Bacteria | 23657 |
| 107 | Ga0466715_364861 | 3300042616 | Bacteria | 4999 |
| 108 | Ga0466723_036926 | 3300042618 | Bacteria | 32420 |
| 109 | Ga0466723_220137 | 3300042618 | Unclassified | 1943 |
| 110 | Ga0466728_410478 | 3300042620 | Bacteria | 6378 |
| 111 | Ga0466703_052440 | 3300042636 | Bacteria | 4599 |
| 112 | Ga0466703_200042 | 3300042636 | Bacteria | 11528 |
| 113 | Ga0466704_085150 | 3300042643 | Bacteria | 8273 |
| 114 | Ga0466704_104989 | 3300042643 | Bacteria | 11862 |
| 115 | Ga0466656_352580 | 3300042550 | Bacteria | 10661 |
| 116 | Ga0466691_077113 | 3300042593 | Bacteria | 29256 |
| 117 | Ga0466696_213083 | 3300042596 | Bacteria | 6950 |
| 118 | Ga0466696_324676 | 3300042596 | Bacteria | 3117 |
| 119 | Ga0466696_380396 | 3300042596 | Bacteria | 4691 |
| 120 | Ga0466707_171999 | 3300042601 | Bacteria | 4800 |
| 121 | Ga0466707_282031 | 3300042601 | Bacteria | 1482 |
| 122 | Ga0466713_036562 | 3300042602 | Bacteria | 10121 |
| 123 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042618 | Ga0466723_036926 | Ga0466723_036926_15953_16873 | 271 |
| 2 | 3300005083 | Ga0068305_10077163 | Ga0068305_100771634 | 276 |
| 3 | 3300042619 | Ga0466726_410456 | Ga0466726_410456_466_1323 | 285 |
| 4 | 3300042624 | Ga0466735_031150 | Ga0466735_031150_145_1002 | 285 |
| 5 | 3300042636 | Ga0466703_256155 | Ga0466703_256155_2361_3218 | 285 |
| 6 | 3300042618 | Ga0466723_220137 | Ga0466723_220137_736_1596 | 286 |
| 7 | 3300042636 | Ga0466703_121914 | Ga0466703_121914_1345_2205 | 286 |
| 8 | 3300042655 | Ga0466727_258950 | Ga0466727_258950_4998_5858 | 286 |
| 9 | 3300005083 | Ga0068305_10055507 | Ga0068305_100555073 | 290 |
| 10 | 3300042590 | Ga0466690_058831 | Ga0466690_058831_357_1256 | 299 |
| 11 | 3300042593 | Ga0466691_077113 | Ga0466691_077113_11537_12436 | 299 |
| 12 | 3300042606 | Ga0466719_564922 | Ga0466719_564922_729_1628 | 299 |
| 13 | 3300042614 | Ga0466712_313568 | Ga0466712_313568_1039_1938 | 299 |
| 14 | 3300042618 | Ga0466723_120929 | Ga0466723_120929_12624_13523 | 299 |
| 15 | 3300042618 | Ga0466723_312949 | Ga0466723_312949_5389_6288 | 299 |
| 16 | 3300042636 | Ga0466703_200042 | Ga0466703_200042_6062_6961 | 299 |
| 17 | 3300042655 | Ga0466727_282938 | Ga0466727_282938_360_1259 | 299 |
| 18 | 3300042590 | Ga0466690_006915 | Ga0466690_006915_480_1382 | 300 |
| 19 | 3300042620 | Ga0466728_016517 | Ga0466728_016517_35215_36123 | 302 |
| 20 | 3300042620 | Ga0466728_337764 | Ga0466728_337764_25220_26128 | 302 |
| 21 | 3300042624 | Ga0466735_223644 | Ga0466735_223644_127_1056 | 302 |
| 22 | 3300042602 | Ga0466713_061789 | Ga0466713_061789_55338_56249 | 303 |
| 23 | 3300042609 | Ga0466722_075834 | Ga0466722_075834_8875_9786 | 303 |
| 24 | 3300005083 | Ga0068305_10055564 | Ga0068305_1005556415 | 304 |
| 25 | 3300042550 | Ga0466656_352580 | Ga0466656_352580_8920_9834 | 304 |
| 26 | 3300042596 | Ga0466696_157739 | Ga0466696_157739_9950_10864 | 304 |
| 27 | 3300042596 | Ga0466696_213083 | Ga0466696_213083_4226_5140 | 304 |
| 28 | 3300042596 | Ga0466696_343468 | Ga0466696_343468_971_1885 | 304 |
| 29 | 3300042599 | Ga0466706_175020 | Ga0466706_175020_1534_2448 | 304 |
| 30 | 3300042600 | Ga0466700_334631 | Ga0466700_334631_297_1211 | 304 |
| 31 | 3300042601 | Ga0466707_171999 | Ga0466707_171999_3826_4740 | 304 |
| 32 | 3300042602 | Ga0466713_010763 | Ga0466713_010763_8462_9376 | 304 |
| 33 | 3300042602 | Ga0466713_011874 | Ga0466713_011874_1267_2181 | 304 |
| 34 | 3300042602 | Ga0466713_033740 | Ga0466713_033740_541_1455 | 304 |
| 35 | 3300042602 | Ga0466713_036562 | Ga0466713_036562_8661_9575 | 304 |
| 36 | 3300042615 | Ga0466711_009358 | Ga0466711_009358_1734_2648 | 304 |
| 37 | 3300042615 | Ga0466711_090418 | Ga0466711_090418_10555_11469 | 304 |
| 38 | 3300042615 | Ga0466711_318661 | Ga0466711_318661_1054_1968 | 304 |
| 39 | 3300042617 | Ga0466718_038049 | Ga0466718_038049_107_1021 | 304 |
| 40 | 3300042620 | Ga0466728_410478 | Ga0466728_410478_1131_2045 | 304 |
| 41 | 3300042622 | Ga0466731_426610 | Ga0466731_426610_927_1841 | 304 |
| 42 | 3300042636 | Ga0466703_274572 | Ga0466703_274572_1525_2439 | 304 |
| 43 | 3300042655 | Ga0466727_179063 | Ga0466727_179063_2810_3724 | 304 |
| 44 | 3300042659 | Ga0466733_006417 | Ga0466733_006417_294_1208 | 304 |
| 45 | iso_pr_bacteria | 2923982719 | 2923985105 | 304 |
| 46 | iso_pr_bacteria | 2940195863 | 2940198293 | 304 |
| 47 | iso_pr_bacteria | 2940199050 | 2940202243 | 304 |
| 48 | iso_pr_bacteria | 2940202316 | 2940204963 | 304 |
| 49 | iso_pr_bacteria | 2940209341 | 2940211384 | 304 |
| 50 | iso_pr_bacteria | 2940346213 | 2940348403 | 304 |
| 51 | iso_pr_bacteria | 2940371297 | 2940372175 | 304 |
| 52 | 3300002462 | JGI24702J35022_10000687 | JGI24702J35022_1000068722 | 305 |
| 53 | 3300002462 | JGI24702J35022_10002383 | JGI24702J35022_1000238310 | 305 |
| 54 | 3300002462 | JGI24702J35022_10016202 | JGI24702J35022_100162023 | 305 |
| 55 | 3300005083 | Ga0068305_10083417 | Ga0068305_1008341714 | 305 |
| 56 | 3300005083 | Ga0068305_10459535 | Ga0068305_104595351 | 305 |
| 57 | 3300010049 | Ga0123356_10196738 | Ga0123356_101967382 | 305 |
| 58 | 3300010167 | Ga0123353_10069135 | Ga0123353_100691352 | 305 |
| 59 | 3300042550 | Ga0466656_248118 | Ga0466656_248118_216_1133 | 305 |
| 60 | 3300042596 | Ga0466696_324982 | Ga0466696_324982_2240_3157 | 305 |
| 61 | 3300042601 | Ga0466707_135192 | Ga0466707_135192_2752_3669 | 305 |
| 62 | 3300042601 | Ga0466707_282031 | Ga0466707_282031_399_1316 | 305 |
| 63 | 3300042605 | Ga0466716_036664 | Ga0466716_036664_429_1346 | 305 |
| 64 | 3300042606 | Ga0466719_215929 | Ga0466719_215929_7316_8233 | 305 |
| 65 | 3300042612 | Ga0466705_418678 | Ga0466705_418678_8279_9196 | 305 |
| 66 | 3300042613 | Ga0466710_279467 | Ga0466710_279467_311_1228 | 305 |
| 67 | 3300042615 | Ga0466711_041848 | Ga0466711_041848_14633_15550 | 305 |
| 68 | 3300042616 | Ga0466715_157292 | Ga0466715_157292_847_1764 | 305 |
| 69 | 3300042616 | Ga0466715_343665 | Ga0466715_343665_9574_10491 | 305 |
| 70 | 3300042616 | Ga0466715_364861 | Ga0466715_364861_1913_2830 | 305 |
| 71 | 3300042618 | Ga0466723_120993 | Ga0466723_120993_22992_23909 | 305 |
| 72 | 3300042619 | Ga0466726_219661 | Ga0466726_219661_4570_5487 | 305 |
| 73 | 3300042654 | Ga0466725_047035 | Ga0466725_047035_1953_2870 | 305 |
| 74 | 3300042655 | Ga0466727_223410 | Ga0466727_223410_1401_2318 | 305 |
| 75 | 3300002462 | JGI24702J35022_10050145 | JGI24702J35022_100501453 | 306 |
| 76 | 3300005071 | Ga0068302_10229902 | Ga0068302_102299023 | 306 |
| 77 | 3300042590 | Ga0466690_017646 | Ga0466690_017646_19379_20299 | 306 |
| 78 | 3300042593 | Ga0466691_087899 | Ga0466691_087899_1710_2630 | 306 |
| 79 | 3300042593 | Ga0466691_138795 | Ga0466691_138795_1131_2051 | 306 |
| 80 | 3300042596 | Ga0466696_074655 | Ga0466696_074655_2453_3373 | 306 |
| 81 | 3300042596 | Ga0466696_135989 | Ga0466696_135989_658_1578 | 306 |
| 82 | 3300042596 | Ga0466696_295020 | Ga0466696_295020_16085_17005 | 306 |
| 83 | 3300042596 | Ga0466696_324676 | Ga0466696_324676_2135_3055 | 306 |
| 84 | 3300042601 | Ga0466707_025476 | Ga0466707_025476_5302_6222 | 306 |
| 85 | 3300042602 | Ga0466713_152634 | Ga0466713_152634_234_1154 | 306 |
| 86 | 3300042605 | Ga0466716_051729 | Ga0466716_051729_4149_5069 | 306 |
| 87 | 3300042606 | Ga0466719_059375 | Ga0466719_059375_804_1724 | 306 |
| 88 | 3300042612 | Ga0466705_140360 | Ga0466705_140360_9349_10269 | 306 |
| 89 | 3300042615 | Ga0466711_182217 | Ga0466711_182217_4383_5303 | 306 |
| 90 | 3300042615 | Ga0466711_386510 | Ga0466711_386510_2746_3666 | 306 |
| 91 | 3300042616 | Ga0466715_188075 | Ga0466715_188075_58199_59119 | 306 |
| 92 | 3300042618 | Ga0466723_068728 | Ga0466723_068728_4654_5574 | 306 |
| 93 | 3300042620 | Ga0466728_360782 | Ga0466728_360782_32350_33270 | 306 |
| 94 | 3300042621 | Ga0466729_031103 | Ga0466729_031103_17276_18196 | 306 |
| 95 | 3300042636 | Ga0466703_038209 | Ga0466703_038209_4319_5239 | 306 |
| 96 | 3300042636 | Ga0466703_320358 | Ga0466703_320358_37883_38803 | 306 |
| 97 | 3300042643 | Ga0466704_093070 | Ga0466704_093070_4976_5896 | 306 |
| 98 | 3300042643 | Ga0466704_181382 | Ga0466704_181382_1315_2235 | 306 |
| 99 | 3300042659 | Ga0466733_144405 | Ga0466733_144405_1342_2262 | 306 |
| 100 | iso_pr_bacteria | 2940205530 | 2940207856 | 306 |
| 101 | iso_pr_bacteria | 2940212447 | 2940214771 | 306 |
| 102 | iso_pr_bacteria | 2940298504 | 2940300704 | 306 |
| 103 | iso_pr_bacteria | 2940302308 | 2940304507 | 306 |
| 104 | iso_pr_bacteria | 2940306115 | 2940308191 | 306 |
| 105 | iso_pr_bacteria | 2940309933 | 2940311910 | 306 |
| 106 | iso_pr_bacteria | 2940313741 | 2940315843 | 306 |
| 107 | iso_pr_bacteria | 2940317558 | 2940319538 | 306 |
| 108 | iso_pr_bacteria | 2940321370 | 2940323143 | 306 |
| 109 | iso_pr_bacteria | 2940325180 | 2940327378 | 306 |
| 110 | iso_pr_bacteria | 2940328985 | 2940331304 | 306 |
| 111 | iso_pr_bacteria | 2940332795 | 2940334895 | 306 |
| 112 | 3300000062 | IMNBL1DRAFT_c0000766 | IMNBL1DRAFT_000076613 | 307 |
| 113 | 3300042596 | Ga0466696_380396 | Ga0466696_380396_3748_4671 | 307 |
| 114 | 3300042599 | Ga0466706_111085 | Ga0466706_111085_2022_2945 | 307 |
| 115 | 3300042605 | Ga0466716_223439 | Ga0466716_223439_113_1036 | 307 |
| 116 | 3300042609 | Ga0466722_001372 | Ga0466722_001372_385_1308 | 307 |
| 117 | 3300042609 | Ga0466722_017922 | Ga0466722_017922_4209_5132 | 307 |
| 118 | 3300042613 | Ga0466710_229280 | Ga0466710_229280_610_1533 | 307 |
| 119 | 3300042616 | Ga0466715_381051 | Ga0466715_381051_476_1399 | 307 |
| 120 | 3300042643 | Ga0466704_085150 | Ga0466704_085150_324_1247 | 307 |
| 121 | 3300042643 | Ga0466704_150058 | Ga0466704_150058_334_1257 | 307 |
| 122 | 3300042643 | Ga0466704_596308 | Ga0466704_596308_4084_5007 | 307 |
| 123 | 3300042606 | Ga0466719_064486 | Ga0466719_064486_1984_2910 | 308 |
| 124 | 3300042624 | Ga0466735_027786 | Ga0466735_027786_2333_3259 | 308 |
| 125 | 3300042648 | Ga0466709_365428 | Ga0466709_365428_5061_6002 | 308 |
| 126 | 3300042593 | Ga0466691_035615 | Ga0466691_035615_4053_4982 | 309 |
| 127 | 3300042612 | Ga0466705_022136 | Ga0466705_022136_1157_2086 | 309 |
| 128 | 3300042616 | Ga0466715_261346 | Ga0466715_261346_10642_11571 | 309 |
| 129 | 3300042648 | Ga0466709_193369 | Ga0466709_193369_4913_5842 | 309 |
| 130 | 3300042590 | Ga0466690_411604 | Ga0466690_411604_4633_5565 | 310 |
| 131 | 3300042602 | Ga0466713_064514 | Ga0466713_064514_9057_9989 | 310 |
| 132 | 3300042606 | Ga0466719_122038 | Ga0466719_122038_5309_6241 | 310 |
| 133 | 3300005083 | Ga0068305_10091325 | Ga0068305_100913256 | 311 |
| 134 | 3300042652 | Ga0466708_293328 | Ga0466708_293328_12274_13212 | 312 |
| 135 | 3300042643 | Ga0466704_104989 | Ga0466704_104989_1560_2501 | 313 |
| 136 | 3300042643 | Ga0466704_397285 | Ga0466704_397285_191_1132 | 313 |
| 137 | 3300042612 | Ga0466705_169781 | Ga0466705_169781_13715_14659 | 314 |
| 138 | 3300042616 | Ga0466715_120257 | Ga0466715_120257_22499_23452 | 317 |
| 139 | 3300042648 | Ga0466709_199995 | Ga0466709_199995_5210_6169 | 319 |
| 140 | 3300042655 | Ga0466727_207748 | Ga0466727_207748_1792_2760 | 322 |
| 141 | 3300042636 | Ga0466703_052440 | Ga0466703_052440_200_1231 | 343 |
| 142 | 3300042620 | Ga0466728_003769 | Ga0466728_003769_33177_34400 | 407 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.