Protein Family IF09105

Metagenome Metatranscriptome Isolate
147 Members
43 Samples
142 Scaffolds
259 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_041270|Ga0466703_041270_11465_12340
Length
291 aa
Sequence
MSSGNSGAPGSRGFFEGGLTRIFKRSGGAAEPAGPAPDTGEEQESPPLDRKILAALNSDQREMVRGIADLSDTTVKEVMVPRIDTVFLSVEASRDELLDRIAESEHSRFPVYQDTIDNVIGILYVKDVLRSLVKNENFDVVKLLRKPFFVPLSKRIDGLLRELRRRRVHIAVVVDEYGGVSGIACMEDIIEEIVGDIQDEFDHETEDLLKLGEGIWLCDARLNLEDLSQKIGVDLPVESFDTLGGFVFDLFGKIPVCYEKAVYRGNDFIIHNMDGHKINTVKIVLHSEEGP

📊 Sample Types

Isolate 3.4%
Metagenome 95.9%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 30.0%
Unclassified 17.5%
Termopsidae 7.5%
Rhinotermitidae 5.0%
Hodotermitidae 2.5%
Blaberidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
17 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
24 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 2772190975 Treponema sp. RmG30 Isolate Blaberidae
37 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
38 2820025825 Unclassified Spirochaetes Lab288P1bin8 Isolate Unclassified
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_338767 3300042612 Bacteria 4588
2 Ga0466704_156418 3300042643 Unclassified 4011
3 Ga0466708_072672 3300042652 Bacteria 1023
4 Ga0466705_419597 3300042612 Bacteria 2305
5 Ga0466723_017518 3300042618 Bacteria 33403
6 Ga0466723_228640 3300042618 Bacteria 18419
7 Ga0466728_358911 3300042620 Bacteria 19107
8 Ga0466719_135362 3300042606 Bacteria 51759
9 Ga0466698_508212 3300042610 Bacteria 1253
10 Ga0123353_10249689 3300010167 Bacteria 2749
11 Ga0466691_021581 3300042593 Bacteria 18132
12 Ga0466696_108305 3300042596 Bacteria 9691
13 JGI24698J34947_10000638 3300002449 Bacteria 16920
14 Ga0072941_1001487 3300005201 Bacteria 51851
15 Ga0466703_110442 3300042636 Bacteria 41999
16 Ga0466708_010042 3300042652 Bacteria 27601
17 Ga0466712_260719 3300042614 Bacteria 20517
18 Ga0466715_016266 3300042616 Bacteria 6832
19 Ga0466715_540587 3300042616 Bacteria 1776
20 Ga0466723_071898 3300042618 Bacteria 30989
21 Ga0466723_255771 3300042618 Bacteria 84056
22 Ga0466726_283753 3300042619 Bacteria 6034
23 Ga0466728_291121 3300042620 Bacteria 1165
24 Ga0466706_215655 3300042599 Bacteria 1421
25 Ga0466707_312716 3300042601 Bacteria 1613
26 Ga0466719_114180 3300042606 Bacteria 19353
27 Ga0466722_063760 3300042609 Bacteria 8858
28 Ga0466722_136820 3300042609 Bacteria 12741
29 Ga0466722_223518 3300042609 Bacteria 4850
30 Ga0123353_10063734 3300010167 Bacteria 5912
31 Ga0466690_195937 3300042590 Bacteria 7101
32 Ga0466691_132898 3300042593 Bacteria 10056
33 Ga0466695_303664 3300042595 Bacteria 2905
34 JGI24698J34947_10004303 3300002449 Bacteria 7749
35 JGI24698J34947_10009458 3300002449 Bacteria 5349
36 Ga0068305_10037418 3300005083 Bacteria 10822
37 Ga0466731_343864 3300042622 Bacteria 2460
38 Ga0466703_146349 3300042636 Bacteria 1993
39 Ga0466727_010861 3300042655 Bacteria 2868
40 Ga0466711_023770 3300042615 Bacteria 2388
41 Ga0466711_038973 3300042615 Bacteria 29172
42 Ga0466715_578351 3300042616 Bacteria 17317
43 Ga0466718_112041 3300042617 Bacteria 1302
44 Ga0466726_284985 3300042619 Bacteria 2230
45 Ga0466728_031070 3300042620 Bacteria 1484
46 Ga0466716_501287 3300042605 Bacteria 1522
47 Ga0466722_192504 3300042609 Bacteria 17517
48 Ga0466722_243657 3300042609 Bacteria 9955
49 Ga0466698_110672 3300042610 Bacteria 1835
50 Ga0123353_10090535 3300010167 Bacteria 4926
51 JGI24698J34947_10001351 3300002449 Bacteria 12896
52 JGI24698J34947_10129497 3300002449 Bacteria 1081
53 Ga0068305_10003169 3300005083 Unclassified 3295
54 Ga0466735_231369 3300042624 Bacteria 1191
55 Ga0466704_102605 3300042643 Bacteria 24428
56 Ga0466704_140776 3300042643 Bacteria 46136
57 Ga0466704_247802 3300042643 Bacteria 5063
58 Ga0466708_164685 3300042652 Bacteria 38582
59 Ga0466712_266336 3300042614 Bacteria 1503
60 Ga0466715_177196 3300042616 Bacteria 13055
61 Ga0466715_242352 3300042616 Bacteria 2199
62 Ga0466726_404177 3300042619 Bacteria 25452
63 Ga0466722_039646 3300042609 Bacteria 15269
64 Ga0466722_144296 3300042609 Bacteria 7214
65 Ga0466722_151628 3300042609 Bacteria 7338
66 Ga0123356_10201563 3300010049 Bacteria 2030
67 Ga0123353_10067080 3300010167 Bacteria 5761
68 Ga0466696_170180 3300042596 Bacteria 28492
69 Ga0466705_023372 3300042612 Bacteria 15735
70 Ga0466705_047752 3300042612 Bacteria 12300
71 Ga0466705_152860 3300042612 Bacteria 2705
72 Ga0466709_216584 3300042648 Bacteria 26302
73 Ga0466708_236919 3300042652 Bacteria 12140
74 Ga0466727_148700 3300042655 Bacteria 10958
75 Ga0466727_321934 3300042655 Bacteria 1526
76 Ga0466705_405348 3300042612 Bacteria 3537
77 Ga0466712_228356 3300042614 Bacteria 2461
78 Ga0466715_055859 3300042616 Bacteria 18639
79 Ga0466715_173704 3300042616 Bacteria 8097
80 Ga0466691_152247 3300042593 Bacteria 2224
81 Ga0466694_050259 3300042594 Bacteria 2075
82 Ga0466733_175294 3300042659 Bacteria 1791
83 Ga0466735_149400 3300042624 Bacteria 1459
84 Ga0466703_382712 3300042636 Bacteria 2516
85 Ga0466704_350973 3300042643 Bacteria 2977
86 Ga0466709_067178 3300042648 Bacteria 17391
87 Ga0466727_238967 3300042655 Unclassified 1475
88 Ga0466726_098931 3300042619 Bacteria 11089
89 Ga0466726_326835 3300042619 Bacteria 6427
90 Ga0466726_359327 3300042619 Bacteria 15666
91 Ga0466726_463099 3300042619 Bacteria 1756
92 Ga0466728_066942 3300042620 Bacteria 22999
93 Ga0466719_515378 3300042606 Bacteria 4834
94 Ga0466719_552202 3300042606 Unclassified 1760
95 Ga0123356_10624715 3300010049 Bacteria 1243
96 Ga0466691_052772 3300042593 Bacteria 8473
97 Ga0466696_445111 3300042596 Unclassified 2205
98 JGI24698J34947_10067324 3300002449 Bacteria 1738
99 JGI24698J34947_10117074 3300002449 Bacteria 1164
100 Ga0466705_284742 3300042612 Bacteria 4788
101 Ga0466735_127293 3300042624 Bacteria 1929
102 Ga0466703_041270 3300042636 Bacteria 17976
103 Ga0466703_065056 3300042636 Bacteria 39614
104 Ga0466711_038496 3300042615 Bacteria 33651
105 Ga0466711_159576 3300042615 Bacteria 11076
106 Ga0466715_504706 3300042616 Bacteria 1421
107 Ga0466718_000723 3300042617 Bacteria 16742
108 Ga0466723_058149 3300042618 Bacteria 34327
109 Ga0466726_153394 3300042619 Bacteria 7581
110 Ga0466700_156442 3300042600 Bacteria 1297
111 Ga0466713_045116 3300042602 Bacteria 6062
112 Ga0466716_045118 3300042605 Bacteria 31234
113 Ga0466716_051202 3300042605 Bacteria 6510
114 Ga0466716_346833 3300042605 Bacteria 5568
115 Ga0123356_10726006 3300010049 Bacteria 1163
116 Ga0123353_10606662 3300010167 Bacteria 1563
117 Ga0123353_10659274 3300010167 Bacteria 1479
118 Ga0264413_117084 3300024493 Bacteria 8556
119 Ga0264413_128195 3300024493 Bacteria 5210
120 Ga0466696_117734 3300042596 Bacteria 5907
121 Ga0466733_198067 3300042659 Bacteria 2663
122 Ga0466703_200059 3300042636 Bacteria 18485
123 Ga0466709_267518 3300042648 Bacteria 6617
124 Ga0466708_083190 3300042652 Bacteria 7723
125 Ga0466727_063694 3300042655 Unclassified 1119
126 Ga0466711_044057 3300042615 Bacteria 8901
127 Ga0466711_199744 3300042615 Bacteria 1088
128 Ga0466715_359022 3300042616 Bacteria 1973
129 Ga0466718_133009 3300042617 Bacteria 4904
130 Ga0466723_127581 3300042618 Bacteria 4407
131 Ga0466723_202240 3300042618 Bacteria 23395
132 Ga0466726_261326 3300042619 Bacteria 8266
133 Ga0466726_301919 3300042619 Bacteria 3079
134 Ga0466707_239817 3300042601 Bacteria 2218
135 Ga0123355_10059231 3300009826 Bacteria 6191
136 Ga0223674_1039998 3300021235 Bacteria 1359
137 Ga0466690_391862 3300042590 Unclassified 2081
138 Ga0466692_006030 3300042591 Bacteria 17726
139 Ga0466692_176791 3300042591 Bacteria 13758
140 Ga0466694_197503 3300042594 Bacteria 3668
141 Ga0466696_129745 3300042596 Bacteria 25058
142 JGI24698J34947_10055585 3300002449 Bacteria 1971

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300021235 Ga0223674_1039998 Ga0223674_10399982 222
2 3300024493 Ga0264413_128195 Ga0264413_1281953 229
3 3300042601 Ga0466707_239817 Ga0466707_239817_490_1242 236
4 3300042616 Ga0466715_359022 Ga0466715_359022_1142_1897 237
5 3300042594 Ga0466694_197503 Ga0466694_197503_37_834 244
6 3300042610 Ga0466698_110672 Ga0466698_110672_835_1626 245
7 3300042659 Ga0466733_198067 Ga0466733_198067_875_1663 245
8 3300010049 Ga0123356_10726006 Ga0123356_107260062 246
9 3300010167 Ga0123353_10090535 Ga0123353_100905352 246
10 3300042655 Ga0466727_321934 Ga0466727_321934_611_1360 249
11 3300042612 Ga0466705_023372 Ga0466705_023372_14872_15624 250
12 3300042636 Ga0466703_110442 Ga0466703_110442_15341_16093 250
13 3300005201 Ga0072941_1001487 Ga0072941_100148717 251
14 3300042596 Ga0466696_117734 Ga0466696_117734_2793_3548 251
15 3300042605 Ga0466716_051202 Ga0466716_051202_1805_2560 251
16 3300042609 Ga0466722_144296 Ga0466722_144296_251_1006 251
17 3300042616 Ga0466715_177196 Ga0466715_177196_8970_9725 251
18 3300042616 Ga0466715_578351 Ga0466715_578351_11340_12095 251
19 3300042616 Ga0466715_504706 Ga0466715_504706_13_771 252
20 3300042620 Ga0466728_031070 Ga0466728_031070_662_1420 252
21 3300042636 Ga0466703_382712 Ga0466703_382712_1241_1999 252
22 3300042605 Ga0466716_501287 Ga0466716_501287_103_864 253
23 3300042609 Ga0466722_039646 Ga0466722_039646_10232_10993 253
24 3300042609 Ga0466722_192504 Ga0466722_192504_10944_11705 253
25 3300042612 Ga0466705_152860 Ga0466705_152860_205_966 253
26 3300042615 Ga0466711_159576 Ga0466711_159576_5439_6200 253
27 3300042616 Ga0466715_173704 Ga0466715_173704_4284_5045 253
28 3300042616 Ga0466715_540587 Ga0466715_540587_921_1682 253
29 3300042618 Ga0466723_127581 Ga0466723_127581_2167_2928 253
30 3300042624 Ga0466735_231369 Ga0466735_231369_30_791 253
31 3300042648 Ga0466709_067178 Ga0466709_067178_12417_13178 253
32 3300042648 Ga0466709_267518 Ga0466709_267518_4167_4928 253
33 3300042652 Ga0466708_083190 Ga0466708_083190_2303_3064 253
34 iso_pr_bacteria 2820025825 2820026786 253
35 3300042593 Ga0466691_021581 Ga0466691_021581_5202_5966 254
36 3300042596 Ga0466696_445111 Ga0466696_445111_1196_1960 254
37 3300042612 Ga0466705_338767 Ga0466705_338767_1155_1919 254
38 3300042615 Ga0466711_044057 Ga0466711_044057_4841_5605 254
39 3300042618 Ga0466723_228640 Ga0466723_228640_13808_14572 254
40 3300042636 Ga0466703_146349 Ga0466703_146349_282_1046 254
41 3300042643 Ga0466704_102605 Ga0466704_102605_10100_10864 254
42 3300042643 Ga0466704_350973 Ga0466704_350973_663_1427 254
43 3300042648 Ga0466709_216584 Ga0466709_216584_1034_1798 254
44 3300042652 Ga0466708_010042 Ga0466708_010042_9826_10590 254
45 3300042622 Ga0466731_343864 Ga0466731_343864_955_1722 255
46 3300042652 Ga0466708_236919 Ga0466708_236919_6714_7481 255
47 3300002449 JGI24698J34947_10004303 JGI24698J34947_100043039 256
48 3300002449 JGI24698J34947_10055585 JGI24698J34947_100555852 256
49 3300042617 Ga0466718_000723 Ga0466718_000723_12573_13343 256
50 iso_pr_bacteria 2781125682 2781409385 256
51 3300042612 Ga0466705_405348 Ga0466705_405348_42_815 257
52 3300042619 Ga0466726_153394 Ga0466726_153394_4537_5310 257
53 3300042619 Ga0466726_261326 Ga0466726_261326_3128_3901 257
54 3300042619 Ga0466726_326835 Ga0466726_326835_428_1201 257
55 3300002449 JGI24698J34947_10009458 JGI24698J34947_100094582 258
56 3300042593 Ga0466691_152247 Ga0466691_152247_482_1258 258
57 3300042617 Ga0466718_112041 Ga0466718_112041_148_924 258
58 3300042590 Ga0466690_195937 Ga0466690_195937_4112_4891 259
59 3300042593 Ga0466691_132898 Ga0466691_132898_7174_7953 259
60 3300042594 Ga0466694_050259 Ga0466694_050259_877_1656 259
61 3300042595 Ga0466695_303664 Ga0466695_303664_173_952 259
62 3300042596 Ga0466696_108305 Ga0466696_108305_3932_4711 259
63 3300042596 Ga0466696_129745 Ga0466696_129745_2987_3766 259
64 3300042596 Ga0466696_170180 Ga0466696_170180_3906_4685 259
65 3300042606 Ga0466719_515378 Ga0466719_515378_3406_4185 259
66 3300042606 Ga0466719_552202 Ga0466719_552202_643_1422 259
67 3300042612 Ga0466705_284742 Ga0466705_284742_548_1327 259
68 3300042612 Ga0466705_419597 Ga0466705_419597_1043_1822 259
69 3300042615 Ga0466711_038496 Ga0466711_038496_21560_22339 259
70 3300042615 Ga0466711_199744 Ga0466711_199744_136_915 259
71 3300042618 Ga0466723_058149 Ga0466723_058149_11130_11909 259
72 3300042618 Ga0466723_202240 Ga0466723_202240_7372_8151 259
73 3300042618 Ga0466723_255771 Ga0466723_255771_80513_81292 259
74 3300042619 Ga0466726_098931 Ga0466726_098931_6360_7139 259
75 3300042619 Ga0466726_283753 Ga0466726_283753_3976_4755 259
76 3300042619 Ga0466726_301919 Ga0466726_301919_627_1406 259
77 3300042619 Ga0466726_404177 Ga0466726_404177_17797_18576 259
78 3300042620 Ga0466728_066942 Ga0466728_066942_4385_5164 259
79 3300042620 Ga0466728_291121 Ga0466728_291121_283_1062 259
80 3300042636 Ga0466703_065056 Ga0466703_065056_36593_37372 259
81 3300042643 Ga0466704_140776 Ga0466704_140776_38251_39030 259
82 3300042643 Ga0466704_156418 Ga0466704_156418_676_1455 259
83 3300042655 Ga0466727_010861 Ga0466727_010861_927_1706 259
84 3300042655 Ga0466727_063694 Ga0466727_063694_235_1014 259
85 3300042655 Ga0466727_148700 Ga0466727_148700_100_879 259
86 3300042655 Ga0466727_238967 Ga0466727_238967_153_932 259
87 iso_pr_bacteria 2781125655 2781319475 259
88 3300009826 Ga0123355_10059231 Ga0123355_100592314 260
89 3300010049 Ga0123356_10201563 Ga0123356_102015632 260
90 3300010049 Ga0123356_10624715 Ga0123356_106247152 260
91 3300010167 Ga0123353_10063734 Ga0123353_100637343 260
92 3300010167 Ga0123353_10249689 Ga0123353_102496892 260
93 3300024493 Ga0264413_117084 Ga0264413_1170845 260
94 3300042590 Ga0466690_391862 Ga0466690_391862_1080_1862 260
95 3300042593 Ga0466691_052772 Ga0466691_052772_3910_4692 260
96 3300042600 Ga0466700_156442 Ga0466700_156442_195_977 260
97 3300042605 Ga0466716_045118 Ga0466716_045118_26070_26852 260
98 3300042605 Ga0466716_346833 Ga0466716_346833_793_1575 260
99 3300042606 Ga0466719_135362 Ga0466719_135362_3775_4557 260
100 3300042612 Ga0466705_047752 Ga0466705_047752_2230_3012 260
101 3300042617 Ga0466718_133009 Ga0466718_133009_2772_3554 260
102 iso_pr_bacteria 2781125681 2781406734 260
103 3300002449 JGI24698J34947_10067324 JGI24698J34947_100673242 261
104 3300002449 JGI24698J34947_10117074 JGI24698J34947_101170741 261
105 3300042601 Ga0466707_312716 Ga0466707_312716_564_1349 261
106 3300042606 Ga0466719_114180 Ga0466719_114180_14763_15548 261
107 3300042614 Ga0466712_228356 Ga0466712_228356_802_1587 261
108 3300042615 Ga0466711_038973 Ga0466711_038973_16401_17186 261
109 3300042620 Ga0466728_358911 Ga0466728_358911_8219_9004 261
110 3300042624 Ga0466735_149400 Ga0466735_149400_596_1381 261
111 3300042652 Ga0466708_164685 Ga0466708_164685_14599_15465 261
112 3300002449 JGI24698J34947_10000638 JGI24698J34947_100006389 262
113 3300002449 JGI24698J34947_10001351 JGI24698J34947_100013515 262
114 3300005083 Ga0068305_10037418 Ga0068305_100374184 262
115 3300042610 Ga0466698_508212 Ga0466698_508212_446_1234 262
116 3300042659 Ga0466733_175294 Ga0466733_175294_231_1019 262
117 iso_pr_bacteria 2772190975 2773722763 262
118 3300042591 Ga0466692_006030 Ga0466692_006030_8799_9593 264
119 3300042599 Ga0466706_215655 Ga0466706_215655_88_882 264
120 3300042614 Ga0466712_260719 Ga0466712_260719_10719_11513 264
121 3300042616 Ga0466715_242352 Ga0466715_242352_503_1297 264
122 3300042619 Ga0466726_359327 Ga0466726_359327_5599_6426 264
123 3300042643 Ga0466704_247802 Ga0466704_247802_1141_1935 264
124 3300042652 Ga0466708_072672 Ga0466708_072672_112_906 264
125 3300010167 Ga0123353_10659274 Ga0123353_106592742 265
126 3300042591 Ga0466692_176791 Ga0466692_176791_4460_5257 265
127 3300010167 Ga0123353_10067080 Ga0123353_100670802 266
128 3300002449 JGI24698J34947_10129497 JGI24698J34947_101294972 268
129 3300042609 Ga0466722_223518 Ga0466722_223518_2291_3097 268
130 3300042614 Ga0466712_266336 Ga0466712_266336_61_867 268
131 3300042619 Ga0466726_284985 Ga0466726_284985_1182_1988 268
132 3300005083 Ga0068305_10003169 Ga0068305_100031695 269
133 3300042616 Ga0466715_055859 Ga0466715_055859_13826_14635 269
134 3300042615 Ga0466711_023770 Ga0466711_023770_504_1319 271
135 3300042602 Ga0466713_045116 Ga0466713_045116_4864_5682 272
136 3300042609 Ga0466722_063760 Ga0466722_063760_4737_5561 274
137 3300042609 Ga0466722_243657 Ga0466722_243657_4271_5095 274
138 3300042618 Ga0466723_071898 Ga0466723_071898_26179_27045 274
139 3300010167 Ga0123353_10606662 Ga0123353_106066622 275
140 3300042609 Ga0466722_151628 Ga0466722_151628_1838_2674 278
141 3300042616 Ga0466715_016266 Ga0466715_016266_716_1552 278
142 3300042609 Ga0466722_136820 Ga0466722_136820_3093_3989 280
143 3300042624 Ga0466735_127293 Ga0466735_127293_1030_1875 281
144 3300042619 Ga0466726_463099 Ga0466726_463099_105_980 283
145 3300042636 Ga0466703_200059 Ga0466703_200059_6533_7387 284
146 3300042618 Ga0466723_017518 Ga0466723_017518_14448_15311 287
147 3300042636 Ga0466703_041270 Ga0466703_041270_11465_12340 291

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03471 CorC_HlyC Transporter associated domain 210 285 0.96
PF00571 CBS CBS domain 75 133 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.52 0.61 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.